DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and NEGR1

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:319 Identity:94/319 - (29%)
Similarity:146/319 - (45%) Gaps:67/319 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISV-THDKHDKHRTWF 121
            ::|:.|..|....|.|.::: |:.|.||::  :|:|:.......:.:||:|: |.:|.|    :.
Human    45 VDNMMVRKGDTAVLRCYLED-GASKGAWLN--RSSIIFAGGDKWSVDPRVSISTLNKRD----YS 102

  Fly   122 LHINNVQEEDRGRYMCQINTV-TAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGS 185
            |.|.||...|.|.|.|.:.|. |.:|....:.|.|||.|.|  .|:|:.|.||.||||.|.|.|.
Human   103 LQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYD--ISNDMTVNEGTNVTLTCLATGK 165

  Fly   186 PEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVP-PSVSKRIKVSV 249
            |||:|.|:.       |:.:.:..: ....|::..|:|...|.|.|.|.|.|. |.| :::||.|
Human   166 PEPSISWRH-------ISPSAKPFE-NGQYLDIYGITRDQAGEYECSAENDVSFPDV-RKVKVVV 221

  Fly   250 DFSPMV--------------WIPHQLVGIPIGFNITLECFIEANPTSLNYWTRE----NDQMITE 296
            :|:|.:              .|..:..|:|              |.:..::..|    |.|....
Human   222 NFAPTIQEIKSGTVTPGRSGLIRCEGAGVP--------------PPAFEWYKGEKKLFNGQQGII 272

  Fly   297 SSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTT 355
            ...:.|.:|           ||:|||....:|||.|||.|..|..:.::.|   :||:|
Human   273 IQNFSTRSI-----------LTVTNVTQEHFGNYTCVAANKLGTTNASLPL---NPPST 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 29/97 (30%)
Ig 69..139 CDD:143165 22/70 (31%)
IG_like 165..249 CDD:214653 31/84 (37%)
IGc2 172..237 CDD:197706 23/64 (36%)
IG_like 267..348 CDD:214653 19/84 (23%)
Ig 270..339 CDD:299845 18/72 (25%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 28/94 (30%)
IGc2 152..210 CDD:197706 23/65 (35%)
Ig_3 225..301 CDD:372822 21/100 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143439
Domainoid 1 1.000 45 1.000 Domainoid score I12195
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.