DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Iglon5

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:330 Identity:95/330 - (28%)
Similarity:148/330 - (44%) Gaps:43/330 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTH 111
            ::|:..||:...:|.||..|.|..|:|.:....: :|||::  :|.||...|...|.:||:.:..
Mouse    28 LLSQSLEFSSPADNYTVCEGDNATLSCFIDEHVT-RVAWLN--RSNILYAGNDRWTSDPRVRLLI 89

  Fly   112 DKHDKHRTWFLHINNVQEEDRGRYMCQINT-VTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDN 175
            :..::   :.:.|..|...|.|.|.|...| ....|...::.|.||..|.:  .||.:.|.||.|
Mouse    90 NTPEE---FSILITQVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPARIVN--ISSPVAVNEGGN 149

  Fly   176 VTLRCKAKGSPEPTIKWKR-DDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPP 239
            |.|.|.|.|.||||:.|:: .||           ...|.:.||:..|.|...|.|.|:..|||..
Mouse   150 VNLLCLAVGRPEPTVTWRQLRDG-----------FTSEGEILEISDIQRGQAGEYECVTHNGVNS 203

  Fly   240 SV-SKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESS----K 299
            :. |:|:.|:|::.|.: .........:|....|.|...|.|.:...|.:: |::::..|    |
Mouse   204 APDSRRVLVTVNYPPTI-TDVTSARTALGRAALLRCEAMAVPPADFQWYKD-DRLLSSGSAEGLK 266

  Fly   300 YKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYM-----SSPPTTQPPP 359
            .:||        :....|...||.:..||||.|.|.|..|....:::|..     :|.|  :||.
Mouse   267 VQTE--------RTRSMLLFANVSARHYGNYTCRAANRLGASSASMRLLRPGSLENSAP--RPPG 321

  Fly   360 TTTTL 364
            ..|.|
Mouse   322 PLTLL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 26/96 (27%)
Ig 69..139 CDD:143165 18/69 (26%)
IG_like 165..249 CDD:214653 32/85 (38%)
IGc2 172..237 CDD:197706 24/65 (37%)
IG_like 267..348 CDD:214653 22/84 (26%)
Ig 270..339 CDD:299845 20/72 (28%)
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 25/93 (27%)
Ig strand A' 41..46 CDD:409353 3/4 (75%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 0/3 (0%)
FR2 61..68 CDD:409353 3/9 (33%)
Ig strand C 61..67 CDD:409353 3/6 (50%)
CDR2 69..79 CDD:409353 4/9 (44%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 1/2 (50%)
FR3 80..115 CDD:409353 9/37 (24%)
Ig strand D 84..91 CDD:409353 1/6 (17%)
Ig strand E 94..100 CDD:409353 0/8 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 1/8 (13%)
FR4 122..129 CDD:409353 1/6 (17%)
Ig strand A 132..137 CDD:409353 2/4 (50%)
Ig_3 134..199 CDD:404760 27/77 (35%)
Ig strand A' 140..145 CDD:409353 1/4 (25%)
Ig strand B 148..157 CDD:409353 4/8 (50%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand D 174..177 CDD:409353 0/2 (0%)
Ig strand E 178..183 CDD:409353 2/4 (50%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig_3 217..295 CDD:404760 21/87 (24%)
putative Ig strand A 218..224 CDD:409353 1/6 (17%)
Ig strand B 234..238 CDD:409353 1/3 (33%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
Ig strand G 301..304 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833597
Domainoid 1 1.000 45 1.000 Domainoid score I12107
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.