DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Gm609

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_011244156.1 Gene:Gm609 / 208166 MGIID:2685455 Length:312 Species:Mus musculus


Alignment Length:137 Identity:30/137 - (21%)
Similarity:54/137 - (39%) Gaps:19/137 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GRNVKLACSVKNLGSY-KVAWMHFEQSAILTV--HNHVITRN---PRISVTHDKHDKHRTWFLHI 124
            |.|:.:.|:..:|.:. ::.|...:.|....:  ::|.....   |.::....|..:..|:|:.|
Mouse    38 GGNISIFCNFTSLENVEQITWQKIQGSLPQNIGTYSHKYGEKILPPYVNRLQCKILEPSTYFMTI 102

  Fly   125 NNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVR------EGDNVTLRCKAK 183
            ..|..||...|.|..||....:..|...:.:       :|.|:::..      ..|..:|.|.|.
Mouse   103 QGVTFEDEACYKCLFNTFPHGSHGGQTCLTI-------ITVSELVTELRSAPGSEDLHSLLCSAV 160

  Fly   184 GSPEPTI 190
            |.|.|.|
Mouse   161 GKPAPGI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 20/94 (21%)
Ig 69..139 CDD:143165 15/75 (20%)
IG_like 165..249 CDD:214653 9/32 (28%)
IGc2 172..237 CDD:197706 8/19 (42%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
Gm609XP_011244156.1 Ig1_MRC-OX-2_like 38..132 CDD:319317 20/93 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.