DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and zig-3

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:217 Identity:58/217 - (26%)
Similarity:94/217 - (43%) Gaps:51/217 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 DIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHD-------------LETDSLEL 218
            |..|..|::|||||....:|...|.|:: ||.:|..:|.|.|.:             :.|.|.::
 Worm    52 DNTVSTGESVTLRCDVLSTPTGVIYWEK-DGQRIQGDKELNVFEKVLNAMGPTVESGIITSSYQI 115

  Fly   219 ERISRLHMGAYLCIASNGVPPSVSKRIKVSVD-----------FSPMVWIPHQLVGIPIGFNI-- 270
            ...:..|:|:|.|:|:|| ..:|....|:||:           .:|::     .:.....|.:  
 Worm   116 PCANLHHIGSYKCVATNG-HDTVESSAKISV
EGQTVKCKSTRRSAPVI-----TMSTESRFELQD 174

  Fly   271 ---TLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKC 332
               ||.|  .|:..:...|..|:.::..:|.:|  |.:|...       |.|..:|.||.|:|.|
 Worm   175 NAATLIC--RADRRANWNWMFEDKKIDFDSGRY--ELLPSGD-------LLIRKIQWSDMGSYFC 228

  Fly   333 VAKNPRGDMDGNIKLYMSSPPT 354
            :|.|..|:..|...||    ||
 Worm   229 IAHNKYGESRGETFLY----PT 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653
Ig 69..139 CDD:143165
IG_like 165..249 CDD:214653 28/94 (30%)
IGc2 172..237 CDD:197706 23/77 (30%)
IG_like 267..348 CDD:214653 23/85 (27%)
Ig 270..339 CDD:299845 20/73 (27%)
zig-3NP_509336.1 I-set 45..145 CDD:254352 28/94 (30%)
Ig 61..142 CDD:143165 24/82 (29%)
IG_like 177..244 CDD:214653 22/77 (29%)
Ig <191..237 CDD:299845 17/54 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.