Sequence 1: | NP_001137799.1 | Gene: | DIP-epsilon / 7354433 | FlyBaseID: | FBgn0259714 | Length: | 467 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510069.1 | Gene: | zig-2 / 192087 | WormBaseID: | WBGene00006979 | Length: | 238 | Species: | Caenorhabditis elegans |
Alignment Length: | 226 | Identity: | 56/226 - (24%) |
---|---|---|---|
Similarity: | 90/226 - (39%) | Gaps: | 63/226 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 164 TSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHD-LETDSLELERISRL--- 224
Fly 225 ---------HMGAYLCIASNGVP--PSVSK------------------RIKVSVDFSPMVWIPHQ 260
Fly 261 LVGIPIGFN-ITLECFIEANPTSLNYWTRENDQMIT-ESSKYKTETIPGHPSYKATMRLTITNVQ 323
Fly 324 SSDYGNYKCVAKNPRGDMDGNIKLYMSSPPT 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-epsilon | NP_001137799.1 | IG_like | 59..155 | CDD:214653 | |
Ig | 69..139 | CDD:143165 | |||
IG_like | 165..249 | CDD:214653 | 26/116 (22%) | ||
IGc2 | 172..237 | CDD:197706 | 20/77 (26%) | ||
IG_like | 267..348 | CDD:214653 | 21/82 (26%) | ||
Ig | 270..339 | CDD:299845 | 19/69 (28%) | ||
zig-2 | NP_510069.1 | I-set | 34..134 | CDD:254352 | 26/96 (27%) |
Ig | 34..121 | CDD:299845 | 22/83 (27%) | ||
Ig | <179..232 | CDD:299845 | 16/61 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |