DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and zig-1

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_492608.2 Gene:zig-1 / 192086 WormBaseID:WBGene00006978 Length:265 Species:Caenorhabditis elegans


Alignment Length:257 Identity:55/257 - (21%)
Similarity:101/257 - (39%) Gaps:48/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VIENITVPAGRNVKLACSVKNLGSYKVAWMHF------------EQSAILTVHNHVITRNPRISV 109
            |:..:|...||..|.|..:....|.:...:|.            .|..|.|.|....:.|.::..
 Worm    11 VVSTVTALGGRGSKSALVLVAARSSENHPLHATDPITIWCAPDNPQVVIKTAHFIRSSDNEKLEA 75

  Fly   110 THDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVV--PPNI------------D 160
            ..:...|:.|:.....:|  :|.|.|.|:::|...|..:   ||.:  .|.:            :
 Worm    76 ALNPTKKNATYTFGSPSV--KDAGEYKCELDTPHGKISH---KVFIYSRPVVHSHEHFTEHEGHE 135

  Fly   161 DALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLH 225
            ..|.|:...|.:|::|||.|...|.|:|.:||.:|.. .:.:::::   .:|..::.:...:...
 Worm   136 FHLESTGTTVEKGESVTLTCPVTGYPKPVVKWTKDSA-PLALSQSV---SMEGSTVIVTNANYTD 196

  Fly   226 MGAYLCIASNGVPPS---------VSKRIKVSVDFSPMVWI-PHQLVGIPIGFNITLECFIE 277
            .|.|.|.|.|....:         |.|.:.|..:|.   |: |..::.|.|...:.:..|.|
 Worm   197 AGTYSCEAVNEYTVNGKTSKMLLVVDKMVDVRSEFQ---WVYPLAVILITIFLLVVIIVFCE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 23/107 (21%)
Ig 69..139 CDD:143165 16/81 (20%)
IG_like 165..249 CDD:214653 22/92 (24%)
IGc2 172..237 CDD:197706 17/64 (27%)
IG_like 267..348 CDD:214653 2/11 (18%)
Ig 270..339 CDD:299845 2/8 (25%)
zig-1NP_492608.2 Ig 28..116 CDD:299845 18/92 (20%)
IGc2 148..207 CDD:197706 16/62 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.