DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and DSCAM

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens


Alignment Length:505 Identity:118/505 - (23%)
Similarity:163/505 - (32%) Gaps:192/505 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SEGNA-------------GNVGGSTLNN----------VISEDPEFTDVIENITVPAGRNVKLAC 73
            ||||.             |.|...|.||          :....|.....::|||..|||:..:.|
Human   461 SEGNVVSYLNISSSQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHC 525

  Fly    74 SVKNLGSYKVAWMHFEQSAILTV-HNHVITRNPRISVTHDKHDKHRTWFLHINNVQEE-DRGRYM 136
            .|.....|.:.|  ::.|.:|.. |..|...|              ...|.:::||:| |.|.|.
Human   526 RVIGYPYYSIKW--YKNSNLLPFNHRQVAFEN--------------NGTLKLSDVQKEVDEGEYT 574

  Fly   137 C------QINTVTAKTQYGFVKVVVPP-------------------------------------- 157
            |      |::|    :|...|.|.|||                                      
Human   575 CNVLVQPQLST----SQSVHVTVKVPPFIQPFEFPRFSIGQRVFIPCVVVSGDLPITITWQKDGR 635

  Fly   158 -----------NIDDALTS-----------------------------SDIIVR----------- 171
                       |||  .||                             |.:|||           
Human   636 PIPGSLGVTIDNID--FTSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQLIVRVPPKFVVQPRD 698

  Fly   172 ----EGDNVTLRCKAKGSPEPTIKWKRDDG------NKIVINKTLEVHDLETDSLELERISRLHM 226
                .|..|.|.|.|:|.|.|||.||...|      ..|.:|..::|  |...||.::.:.....
Human   699 QDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQV--LSNGSLLIKHVVEEDS 761

  Fly   227 GAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITL---------ECFIEANPTS 282
            |.|||..||.|...|||.:.::|.      ||..:...|   |.||         .|........
Human   762 GYYLCKVSNDVGADVSKSMYLTVK------IPAMITSYP---NTTLATQGQKKEMSCTAHGEKPI 817

  Fly   283 LNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKL 347
            :..|.:|:..:..|.::|...|........:|:::..|  ...|.|.:.|.|.|..|:..|.|:|
Human   818 IVRWEKEDRIINPEMARYLVSTKEVGEEVISTLQILPT--VREDSGFFSCHAINSYGEDRGIIQL 880

  Fly   348 YMSSPPTTQPP--------PTTTTLRRTTTTAAEIALDGYINTPLNGNGI 389
            .:..||  .||        ..|.|||.|      :..||  |:|:.|..|
Human   881 TVQEPP--DPPEIEIKDVKARTITLRWT------MGFDG--NSPITGYDI 920

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 28/103 (27%)
Ig 69..139 CDD:143165 17/77 (22%)
IG_like 165..249 CDD:214653 34/133 (26%)
IGc2 172..237 CDD:197706 25/70 (36%)
IG_like 267..348 CDD:214653 19/89 (21%)
Ig 270..339 CDD:299845 15/77 (19%)
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352
I-set 315..385 CDD:333254
Ig_3 407..488 CDD:316449 7/26 (27%)
IGc2 518..575 CDD:197706 18/72 (25%)
I-set 596..686 CDD:333254 8/91 (9%)
Ig_DSCAM 707..784 CDD:143211 28/78 (36%)
Ig 802..889 CDD:325142 19/90 (21%)
FN3 885..978 CDD:238020 15/46 (33%)
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.