DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and zig-4

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:301 Identity:63/301 - (20%)
Similarity:110/301 - (36%) Gaps:101/301 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 MHFE-QSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYG 149
            ||.| .||::|:.|.:.|                                     |.:|:..:  
 Worm    20 MHAEMHSAVVTLANEIDT-------------------------------------NYLTSPAK-- 45

  Fly   150 FVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHD---- 210
             :|:|.|  ::.||      :..|:...|||....:|..||.|| .:|..|..:..|.|.:    
 Worm    46 -IKIVAP--LESAL------IPGGETYQLRCDIMSTPAATIHWK-FNGKLIQGSNELNVEEKLLN 100

  Fly   211 ---------LETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVD-----------FSPMV 255
                     :....|.::..|..:.|.|.|:..|| ..::....:|.::           .:|.:
 Worm   101 FGKAIVDTGIVASILTIQCPSAENSGTYSCVGYNG-HQTIETVAEVEIEGEASGCRSNHKSAPEI 164

  Fly   256 --WIP--HQLVGIPIGFNI-TLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATM 315
              |..  .::.|     |: ||.|  .|| ..:::....||:::..:.|:   |:..:..     
 Worm   165 VFWTDSRFEMTG-----NVATLVC--RAN-QQVDWVWMSNDELVKNNDKF---TVLSNGD----- 213

  Fly   316 RLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQ 356
             |.|.|:...|.|.|.|:|:|..|:......||    ||.:
 Worm   214 -LVIKNIVWDDMGTYTCIARNQFGEARQETFLY----PTAK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 11/69 (16%)
Ig 69..139 CDD:143165 8/53 (15%)
IG_like 165..249 CDD:214653 21/96 (22%)
IGc2 172..237 CDD:197706 19/77 (25%)
IG_like 267..348 CDD:214653 20/81 (25%)
Ig 270..339 CDD:299845 18/69 (26%)
zig-4NP_509335.1 I-set 47..147 CDD:254352 26/109 (24%)
Ig 65..144 CDD:143165 19/80 (24%)
IG_like 176..245 CDD:214653 21/85 (25%)
Ig <193..238 CDD:299845 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.