DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and zig-7

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_491451.2 Gene:zig-7 / 172096 WormBaseID:WBGene00006984 Length:239 Species:Caenorhabditis elegans


Alignment Length:246 Identity:54/246 - (21%)
Similarity:93/246 - (37%) Gaps:72/246 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NNVISEDPEFTDVIENITVPAGRNVK-LACSVKNLGSY-KVAWMHFEQSAILTVHNHVITRNPRI 107
            |..:...||......|.|:.|  |:: |.|..:|||.: .|.:..|.:.:...|....:.:.   
 Worm    28 NLAVVGSPESHVGTPNKTLYA--NIQNLWCGAQNLGEHIDVEYGEFTRLSDGKVFKGTVNQG--- 87

  Fly   108 SVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNID--DALTSSDIIV 170
                       ..:|.|.....:..|||.|::.|:..:...|.:.:.:||.:|  .|:..|:::.
 Worm    88 -----------KVYLEIGKASVKVAGRYRCEVRTLDKEIHSGNLIIYMPPVLDFPAAVRVSEVLN 141

  Fly   171 R-------------EGDNVTLRCKAKGSPEPTIKWKRD------------DGNKIVINKTLEVHD 210
            .             .|:.:.|.|....:|||.::|:::            |||.:::|...|.  
 Worm   142 ARPPHVIGAERRGLHGERMVLECPVLANPEPMVRWEKNGEPLGNSDSIEYDGNNLILNSLTED-- 204

  Fly   211 LETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQL 261
                          |:|.|.||..|..|        :.|| .|.  ||||:
 Worm   205 --------------HIGKYRCIGDNSFP--------LFVD-GPA--IPHQI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 20/97 (21%)
Ig 69..139 CDD:143165 14/71 (20%)
IG_like 165..249 CDD:214653 20/108 (19%)
IGc2 172..237 CDD:197706 18/76 (24%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
zig-7NP_491451.2 IGc2 157..216 CDD:197706 17/74 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.