DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Mag

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001333013.1 Gene:Mag / 17136 MGIID:96912 Length:627 Species:Mus musculus


Alignment Length:347 Identity:88/347 - (25%)
Similarity:150/347 - (43%) Gaps:63/347 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VGL-GCLIASSVALSTDTGSEGN-AGNVGGSTLNNVISEDPEFTDVIE--NITVP----AGRNVK 70
            :|| .|.:..| .||.:.|.:.. .|::||  .|.....:....|::.  ||.||    ||..|:
Mouse    95 LGLRNCTLLLS-TLSPELGGKYYFRGDLGG--YNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVE 156

  Fly    71 LACSV-KNLGSYK--VAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTW----FLHINNVQ 128
            ::|.| .|....:  ::|:..|.....||...:             .:...||    .||....:
Mouse   157 VSCMVPDNCPELRPELSWLGHEGLGEPTVLGRL-------------REDEGTWVQVSLLHFVPTR 208

  Fly   129 EEDRGRYMCQI---NTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTI 190
            |.:..|..||.   ||......|..:.|..||.|.:..:|.:.|  ||.:|:|.|.|..:|.|.:
Mouse   209 EANGHRLGCQAAFPNTTLQFEGYASLDVKYPPVIVEMNSSVEAI--EGSHVSLLCGADSNPPPLL 271

  Fly   191 KWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMV 255
            .|.||.   :|:.:.:    .::..|:||.::....|.|.|:|.|..... ::.:::||.::|  
Mouse   272 TWMRDG---MVLREAV----AKSLYLDLEEVTPGEDGVYACLAENAYGQD-NRTVELSVMYAP-- 326

  Fly   256 WIP---HQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRL 317
            |.|   ..:|.:. |..:::.|..::||          |.::|   .:|.:.|.....|::.::|
Mouse   327 WKPTVNGTVVAVE-GETVSILCSTQSNP----------DPILT---IFKEKQILATVIYESQLQL 377

  Fly   318 TITNVQSSDYGNYKCVAKNPRG 339
            .:..|...|.|.|.|||:|..|
Mouse   378 ELPAVTPEDDGEYWCVAENQYG 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 26/111 (23%)
Ig 69..139 CDD:143165 15/76 (20%)
IG_like 165..249 CDD:214653 22/83 (27%)
IGc2 172..237 CDD:197706 20/64 (31%)
IG_like 267..348 CDD:214653 19/73 (26%)
Ig 270..339 CDD:299845 17/68 (25%)
MagNP_001333013.1 Interaction with RTN4R and RTN4RL2. /evidence=ECO:0000250|UniProtKB:P07722 20..325 65/255 (25%)
IgV_CD33 22..137 CDD:409377 11/44 (25%)
Ig strand B 38..42 CDD:409377
Ig strand C 56..60 CDD:409377
Ganglioside GT1b binding. /evidence=ECO:0000269|PubMed:27922006 65..67
Ig strand E 100..104 CDD:409377 1/3 (33%)
Ig strand F 114..119 CDD:409377 0/4 (0%)
Ganglioside GT1b binding. /evidence=ECO:0000269|PubMed:27922006 124..128 1/3 (33%)
Ig strand G 128..133 CDD:409377 0/4 (0%)
IgC2_CD33_d2_like 141..235 CDD:409579 25/106 (24%)
Ig strand B 155..159 CDD:409579 1/3 (33%)
Ig strand C 171..175 CDD:409579 0/3 (0%)
Ig strand E 200..204 CDD:409579 1/3 (33%)
Ig strand F 214..219 CDD:409579 2/4 (50%)
Ig strand G 229..232 CDD:409579 0/2 (0%)
Ig_3 239..309 CDD:404760 24/78 (31%)
Ig strand A 239..242 CDD:409353 2/2 (100%)
Ig strand A' 248..251 CDD:409353 1/2 (50%)
Ig strand B 256..264 CDD:409353 3/7 (43%)
Ig strand C 270..274 CDD:409353 0/3 (0%)
Ig strand C' 277..280 CDD:409353 0/5 (0%)
Ig strand E 289..293 CDD:409353 1/3 (33%)
Ig strand F 301..309 CDD:409353 4/7 (57%)
Ig strand G 312..322 CDD:409353 0/10 (0%)
IG 333..409 CDD:214652 20/81 (25%)
Required for normal axon myelination in the central nervous system. /evidence=ECO:0000269|PubMed:9482783 578..627
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.