Sequence 1: | NP_001137799.1 | Gene: | DIP-epsilon / 7354433 | FlyBaseID: | FBgn0259714 | Length: | 467 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001192272.1 | Gene: | Papln / 170721 | MGIID: | 2386139 | Length: | 1302 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 46/199 - (23%) |
---|---|---|---|
Similarity: | 74/199 - (37%) | Gaps: | 65/199 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 157 PNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETD-SLELER 220
Fly 221 ISRLHMGAYLCIASN--------------------GVPPSVSKRIKVSVDFSPMVWIPHQLVGIP 265
Fly 266 IGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNY 330
Fly 331 KCVA 334 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-epsilon | NP_001137799.1 | IG_like | 59..155 | CDD:214653 | |
Ig | 69..139 | CDD:143165 | |||
IG_like | 165..249 | CDD:214653 | 27/104 (26%) | ||
IGc2 | 172..237 | CDD:197706 | 23/85 (27%) | ||
IG_like | 267..348 | CDD:214653 | 16/68 (24%) | ||
Ig | 270..339 | CDD:299845 | 15/65 (23%) | ||
Papln | NP_001192272.1 | TSP1 | 30..81 | CDD:214559 | |
ADAM_spacer1 | 184..299 | CDD:368694 | |||
TSP1 | 309..362 | CDD:214559 | |||
TSP1 | 389..447 | CDD:214559 | |||
TSP1 | 447..504 | CDD:214559 | |||
TSP1 | 511..562 | CDD:214559 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 563..648 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 694..737 | ||||
Kunitz_BPTI | 771..822 | CDD:333766 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 822..924 | ||||
Papilin_u7 | 831..922 | CDD:374683 | |||
Ig | 932..>995 | CDD:386229 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1024..1064 | ||||
I-set | 1070..1141 | CDD:369462 | 26/81 (32%) | ||
Ig | 1157..1241 | CDD:386229 | 20/101 (20%) | ||
PLAC | 1257..1289 | CDD:370061 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |