DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and IGSF5

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_011527774.1 Gene:IGSF5 / 150084 HGNCID:5952 Length:497 Species:Homo sapiens


Alignment Length:259 Identity:57/259 - (22%)
Similarity:109/259 - (42%) Gaps:48/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVH 97
            |.|||:..|    |.:.|.|      :|..|..|...:..|:|..  .:|:.........:|:|.
Human   120 EKNAGSGSG----NEVIEGP------QNARVLKGSQARFNCTVSQ--GWKLIMWALSDMVVLSVR 172

  Fly    98 --NHVITRNPRISVTHDKHDK--HRTWFLHINNVQEEDRGRYMCQI-NTVTAKTQYGFVKVV--- 154
              ..:|| |.|.  |..::|:  :.|..:.|:||:..|.|...|.: |:....:.|..|:|:   
Human   173 PMEPIIT-NDRF--TSQRYDQGGNFTSEMIIHNVEPSDSGNIRCSLQNSRLHGSAYLTVQVMGEL 234

  Fly   155 -VPPNIDDALTSSDIIVREGDNVTLRC-KAKGSPEPTIKWKRDDGNKIVINKTL----EVHDLET 213
             :|        |.:::|.|.:...:.| .:..:..|.|.|:.   ..:|.:.:.    |..||::
Human   235 FIP--------SVNLVVAENEPCEVTCLPSHWTRLPDISWEL---GLLVSHSSYYFVPEPSDLQS 288

  Fly   214 DSLELERISRLHMGAYLCIAS-NGVPPSVSKRIKVSVDFSPM-----VWIPHQLVGIP-IGFNI 270
             ::.:..::....|...|:|: ..:....|..:.::|...|.     :.||..|..:| :||::
Human   289 -AVSILALTPQSNGTLTCVATWKSLKARKSATVNLTVIRCPQDTGGGINIPGVLSSLPSLGFSL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 25/104 (24%)
Ig 69..139 CDD:143165 18/73 (25%)
IG_like 165..249 CDD:214653 15/89 (17%)
IGc2 172..237 CDD:197706 12/70 (17%)
IG_like 267..348 CDD:214653 2/4 (50%)
Ig 270..339 CDD:299845 0/1 (0%)
IGSF5XP_011527774.1 IG_like 135..228 CDD:214653 24/103 (23%)
Ig <200..230 CDD:299845 9/29 (31%)
Ig 236..307 CDD:299845 14/82 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.