DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and AgaP_AGAP009253

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_320040.3 Gene:AgaP_AGAP009253 / 1280215 VectorBaseID:AGAP009253 Length:258 Species:Anopheles gambiae


Alignment Length:212 Identity:61/212 - (28%)
Similarity:89/212 - (41%) Gaps:18/212 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ISEDPEF-TDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTH 111
            :...|.| ....:|||...|:...|.|.|||:|:..|:|:......:|||.....|.:.|....|
Mosquito    48 LDRGPHFDLSASKNITALVGKTAYLNCRVKNIGNKTVSWVRHRDIHLLTVGRFTYTSDQRFQAVH 112

  Fly   112 DKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNV 176
            :....  .|.|.|...|:.|.|.|.|||:|........|:.||.|  |...:...|:.:..|..|
Mosquito   113 NPQTD--DWSLQIRYPQKRDTGVYECQISTTPPVGHSMFLAVVEP--ITTIVGVPDLYINTGSTV 173

  Fly   177 TLRCKAKGSPEP--TIKWKRD-----------DGNKIVINKTLEVHDLETDSLELERISRLHMGA 228
            .|.|..:.||||  ||.|..:           |..:..::...|..:|.|..|.::|......|.
Mosquito   174 NLTCIVRNSPEPPSTIFWTHNNQVSGEGEINYDSPRGGVSVITEKGELTTSYLLIQRARTTDSGK 238

  Fly   229 YLCIASNGVPPSVSKRI 245
            |:|..||..|.:::..|
Mosquito   239 YVCSPSNADPSTINVHI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 31/95 (33%)
Ig 69..139 CDD:143165 22/69 (32%)
IG_like 165..249 CDD:214653 25/94 (27%)
IGc2 172..237 CDD:197706 22/77 (29%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
AgaP_AGAP009253XP_320040.3 IG_like 59..147 CDD:214653 29/89 (33%)
Ig 62..143 CDD:299845 28/82 (34%)
IG_like 163..255 CDD:214653 24/91 (26%)
IGc2 170..246 CDD:197706 21/75 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.