DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and AgaP_AGAP009596

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_318623.4 Gene:AgaP_AGAP009596 / 1278969 VectorBaseID:AGAP009596 Length:658 Species:Anopheles gambiae


Alignment Length:404 Identity:92/404 - (22%)
Similarity:151/404 - (37%) Gaps:98/404 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LNNVISED---PEFTDVIEN-ITVP----AGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHV 100
            :|.||.:|   ....||||| :..|    :..|....|...|....:..    |.|.:|.:|...
Mosquito   168 INGVIVDDQYEQNSGDVIENRLLWPTIQRSDLNAIFTCQTMNTKLVEPK----ETSYVLDMHLKP 228

  Fly   101 IT---RNPRISVTHDKH------------DKHRTWF----------------------LHINNVQ 128
            :|   .||..::..||.            :...||:                      |......
Mosquito   229 LTIKVINPPATLVADKRYEIVCQSTGSRPNAIITWYKGKRQMRRTRDETVDHNTTTSTLSFAPTT 293

  Fly   129 EEDRGRYMCQ-----INTVTAKTQYGFVKVVVPPNIDDALTSSDII--VREGDNVTLRCKAKGSP 186
            |:|.....|:     :|.:..:|.:. :.||.||.:...|..:.::  ::|||:|...|..:.:|
Mosquito   294 EDDGKTLTCRAENPNVNGLFLETDWK-MNVVYPPMVTIQLGPTLVVDDIKEGDDVYFECHVRANP 357

  Fly   187 EPTIKWKRDD--GNKIVINKTLEVHDLET-DSLELERISRLHMGAYLCIASNGVPPSVSKRIKVS 248
            :    |||..  .|.:::........::: .||.|:::::...|.|.|.|.|....:||.:..:.
Mosquito   358 D----WKRLQWFHNDVLLQYNGSARIIQSGQSLVLQKVTKQSAGYYACSAINAEGETVSDQQHLR 418

  Fly   249 VDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIP--GHPSY 311
            |..:....|   |:|.....|:.:.|.|.|:|.:.::..|.|:         ..|.:|  .| .|
Mosquito   419 VKRNNRNAI---LIGASRNENVEIPCHIFADPPARSFHWRFNN---------SAEILPVDAH-RY 470

  Fly   312 KATMRLTITN---VQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQ------PPPTTT-TLRR 366
            .:...::|.|   |...|:|...|.|.|..|.        .|.|.|.|      |.|.:. :|..
Mosquito   471 TSQGNISILNYAPVTDQDFGTLTCWAVNEVGP--------QSQPCTFQLVLADLPSPVSNCSLPN 527

  Fly   367 TTTTAAEI-ALDGY 379
            .|...||| ...||
Mosquito   528 RTQQFAEIQCTPGY 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 24/142 (17%)
Ig 69..139 CDD:143165 17/111 (15%)
IG_like 165..249 CDD:214653 20/88 (23%)
IGc2 172..237 CDD:197706 18/67 (27%)
IG_like 267..348 CDD:214653 20/85 (24%)
Ig 270..339 CDD:299845 18/73 (25%)
AgaP_AGAP009596XP_318623.4 V-set 12..118 CDD:284989
IG_like 12..101 CDD:214653
Ig 146..209 CDD:299845 12/40 (30%)
Ig 234..308 CDD:299845 10/73 (14%)
IG_like 247..310 CDD:214653 6/62 (10%)
IGc2 343..408 CDD:197706 18/68 (26%)
IG_like 431..508 CDD:214653 22/94 (23%)
ig 431..504 CDD:278476 20/90 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.