DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and AgaP_AGAP005794

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_315806.4 Gene:AgaP_AGAP005794 / 1276459 VectorBaseID:AGAP005794 Length:421 Species:Anopheles gambiae


Alignment Length:242 Identity:62/242 - (25%)
Similarity:100/242 - (41%) Gaps:27/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FLYVGLGCLIASSVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSV 75
            ||:.....|:.||..|:....::....|..|...:..|:::.  |.||..    .|....|.|||
Mosquito    52 FLFSQPPYLLFSSFPLADSNEAKAAHRNSLGPLQSQFITKNN--TRVISQ----RGGLAVLPCSV 110

  Fly    76 KNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQIN 140
            .......|:|...:...:|||.....:.:.|..|.|.:|  ...|.|.|.|.::||.|.|.|||:
Mosquito   111 TMTTPATVSWFRRKDYQLLTVGLSTYSSDDRFLVEHTRH--LGNWALRIKNARKEDEGLYECQIS 173

  Fly   141 TVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEP-----------TIKWKR 194
              |...|..|:::.:...:.:.|.:.|:.:.||..:.|.||.|.:.|.           .:.:.:
Mosquito   174 --THPPQSIFIELRIVEAVAEILEAPDLHIDEGSTLRLECKLKRATESPLYVFWYHEDRMVNYDQ 236

  Fly   195 DDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSV 241
            :||..:..||      |.:..|.:...:..|.|.|.|..:|....||
Mosquito   237 EDGVSVSNNK------LTSSILTVRNATARHGGNYTCAPANARQSSV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 28/95 (29%)
Ig 69..139 CDD:143165 22/69 (32%)
IG_like 165..249 CDD:214653 21/88 (24%)
IGc2 172..237 CDD:197706 18/75 (24%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
AgaP_AGAP005794XP_315806.4 Ig 92..179 CDD:299845 29/96 (30%)
IG_like 99..173 CDD:214653 24/79 (30%)
IG_like 197..281 CDD:214653 21/87 (24%)
ig 203..267 CDD:278476 16/69 (23%)
CCC1_like <305..362 CDD:294198
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.