DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and AgaP_AGAP010542

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_314509.4 Gene:AgaP_AGAP010542 / 1275271 VectorBaseID:AGAP010542 Length:168 Species:Anopheles gambiae


Alignment Length:144 Identity:47/144 - (32%)
Similarity:66/144 - (45%) Gaps:9/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YVGLGCLIASSVA-LSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVI-ENITVPAGRNVKLACSV 75
            |.|....:.:|.| |.|...|....|....|..     |:|.|.|.. .|:|...|::..|:|.|
Mosquito    32 YDGYKSFLDTSTAHLRTYVASGSTPGQTSQSKW-----EEPYFDDTTPRNVTGLVGKSAYLSCRV 91

  Fly    76 KNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQIN 140
            ||||:..|:|:......||||.::..|.:.|...||  |.....|.|.|...|:.|.|.|.|||:
Mosquito    92 KNLGNKTVSWIRHRDIHILTVGSYTYTSDQRFQATH--HKDVDDWTLQIKWAQKRDAGIYECQIS 154

  Fly   141 TVTAKTQYGFVKVV 154
            |...::.:..:.||
Mosquito   155 TQPVRSYFVTLSVV 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 34/96 (35%)
Ig 69..139 CDD:143165 26/69 (38%)
IG_like 165..249 CDD:214653
IGc2 172..237 CDD:197706
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
AgaP_AGAP010542XP_314509.4 V-set 72..168 CDD:284989 32/97 (33%)
IG_like 74..167 CDD:214653 32/94 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.