DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and AgaP_AGAP005068

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_313942.4 Gene:AgaP_AGAP005068 / 1274750 VectorBaseID:AGAP005068 Length:305 Species:Anopheles gambiae


Alignment Length:209 Identity:57/209 - (27%)
Similarity:85/209 - (40%) Gaps:29/209 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTW 120
            ||..|:||..|:...|.|.|:.||...|||:......|||:.....|.:.|..|...:...:  |
Mosquito    18 DVPRNLTVTVGQTGFLHCRVERLGDQDVAWIRQRDLHILTMGASTYTSDQRFQVIRPEGSVN--W 80

  Fly   121 FLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGS 185
            .|.|...|..|.|.|.||||| ..|....:|..|:.... ..|..|||.::.|..:|:.|..:..
Mosquito    81 TLQIKYPQTRDSGVYECQINT-EPKMSLSYVLNVIELRA-RILGPSDIFIKSGSEITMVCVIQQG 143

  Fly   186 PEP--TIKWKR---------------DDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIA 233
            |..  |:.|.:               .|..:|.|.  .:..|..|..|:::|..:...|.|.|: 
Mosquito   144 PHELGTVFWYKGRYCQPLAQENDIHSGDRGRITIE--TDWTDALTSRLKIKRAIQGDTGNYTCV- 205

  Fly   234 SNGVPPSVSKRIKV 247
                 |::::...|
Mosquito   206 -----PTMARSASV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 32/95 (34%)
Ig 69..139 CDD:143165 22/69 (32%)
IG_like 165..249 CDD:214653 21/100 (21%)
IGc2 172..237 CDD:197706 16/81 (20%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
AgaP_AGAP005068XP_313942.4 IG_like 20..113 CDD:214653 32/95 (34%)
Ig 23..99 CDD:299845 25/77 (32%)
Ig 134..205 CDD:143165 14/72 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.