DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and AgaP_AGAP002707

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_312221.5 Gene:AgaP_AGAP002707 / 1273261 VectorBaseID:AGAP002707 Length:499 Species:Anopheles gambiae


Alignment Length:268 Identity:62/268 - (23%)
Similarity:98/268 - (36%) Gaps:84/268 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PEFTDVIENITVPAGRNVK--------LACSVKNLGSYKVAWMH--FEQSAILTVHNHVITRNPR 106
            |.|.:.: |:|..|...|.        |.|.|..|....|.|:.  .::.::|||.|:..:.:||
Mosquito   197 PFFEEPV-NVTSGAALQVGYHLSTEAILNCRVGMLKDKTVMWIRRTTDKVSLLTVGNNTYSGDPR 260

  Fly   107 ISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPP-NIDDAL--TSSDI 168
            |.|   |......|.||||.::.:|.|.||||::|...:.....:.|:.|. .|.|.:  ..||.
Mosquito   261 IKV---KFQYPNNWRLHINPIKSDDAGLYMCQVSTHPPRVFATNLTVLEPAVRIVDEMGYEFSDR 322

  Fly   169 IVREGDNVTLRCKAKGS------PEPT---------------------------IKWKRDDGNKI 200
            ..:.|..:.:.|:...|      |.|.                           .|..:|| ||:
Mosquito   323 YYKLGSTIEISCQVSTSYLATLPPSPKSAGQQQRSKTSPVGASANALDETAKTGSKATKDD-NKL 386

  Fly   201 -------VINKTLEVHDLETD--------------SLELERISRLHMGAYLCIAS---------- 234
                   :|:.|.:..:|..|              .|.:.:.:|:|.|.|.|..:          
Mosquito   387 SDSTERGLISWTKDGAELPKDVKMSFSGTKQWLISRLSILQANRVHNGVYNCTVAGKQSQAAQVQ 451

  Fly   235 --NGVPPS 240
              ||..|:
Mosquito   452 VLNGETPA 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 32/105 (30%)
Ig 69..139 CDD:143165 26/79 (33%)
IG_like 165..249 CDD:214653 25/142 (18%)
IGc2 172..237 CDD:197706 21/130 (16%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
AgaP_AGAP002707XP_312221.5 IG_like 221..304 CDD:214653 27/85 (32%)
Ig <237..305 CDD:299845 22/70 (31%)
Ig <395..443 CDD:299845 10/47 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.