Sequence 1: | NP_001137799.1 | Gene: | DIP-epsilon / 7354433 | FlyBaseID: | FBgn0259714 | Length: | 467 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_312221.5 | Gene: | AgaP_AGAP002707 / 1273261 | VectorBaseID: | AGAP002707 | Length: | 499 | Species: | Anopheles gambiae |
Alignment Length: | 268 | Identity: | 62/268 - (23%) |
---|---|---|---|
Similarity: | 98/268 - (36%) | Gaps: | 84/268 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 PEFTDVIENITVPAGRNVK--------LACSVKNLGSYKVAWMH--FEQSAILTVHNHVITRNPR 106
Fly 107 ISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPP-NIDDAL--TSSDI 168
Fly 169 IVREGDNVTLRCKAKGS------PEPT---------------------------IKWKRDDGNKI 200
Fly 201 -------VINKTLEVHDLETD--------------SLELERISRLHMGAYLCIAS---------- 234
Fly 235 --NGVPPS 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-epsilon | NP_001137799.1 | IG_like | 59..155 | CDD:214653 | 32/105 (30%) |
Ig | 69..139 | CDD:143165 | 26/79 (33%) | ||
IG_like | 165..249 | CDD:214653 | 25/142 (18%) | ||
IGc2 | 172..237 | CDD:197706 | 21/130 (16%) | ||
IG_like | 267..348 | CDD:214653 | |||
Ig | 270..339 | CDD:299845 | |||
AgaP_AGAP002707 | XP_312221.5 | IG_like | 221..304 | CDD:214653 | 27/85 (32%) |
Ig | <237..305 | CDD:299845 | 22/70 (31%) | ||
Ig | <395..443 | CDD:299845 | 10/47 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |