DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and AgaP_AGAP011128

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_309518.4 Gene:AgaP_AGAP011128 / 1270797 VectorBaseID:AGAP011128 Length:269 Species:Anopheles gambiae


Alignment Length:248 Identity:70/248 - (28%)
Similarity:106/248 - (42%) Gaps:45/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IASSVALS-TDTGSEGNAG-NVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYK 82
            |::|:||| .::|:...|| .:.||.              :.|:|...|.:..|.|.||.||:..
Mosquito     3 ISTSLALSKLNSGATFFAGPYLDGSG--------------VSNVTTQIGTHAYLPCKVKQLGNKS 53

  Fly    83 VAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINT---VTA 144
            |:|:......||||.......:.|....:  .:....|.|.|..||..|.|.|.||::|   ::|
Mosquito    54 VSWVRVRDDHILTVDRMTFIADERFQSFY--VESSGVWTLQIKYVQARDAGIYECQVSTEPKISA 116

  Fly   145 KTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPT--IKWKRDDGNKIVINKTLE 207
            :..   :.||||..  :.:..||..|:.|..|.|||..:|:.||.  |.|..  |.:.:..::..
Mosquito   117 RVH---LHVVVPRT--ELIGDSDRYVKAGSAVILRCVVRGALEPPSYIIWYH--GTQQIFTESRR 174

  Fly   208 ---------VHDLETD------SLELERISRLHMGAYLCIASNGVPPSVSKRI 245
                     ..||:.|      ||.:|...:...|.|.|..||..|.:||..:
Mosquito   175 GWKTQLDRGAPDLDGDIHSTIGSLIIESTRKKDSGNYSCSPSNSPPITVSLHV 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 29/98 (30%)
Ig 69..139 CDD:143165 22/69 (32%)
IG_like 165..249 CDD:214653 28/98 (29%)
IGc2 172..237 CDD:197706 22/81 (27%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
AgaP_AGAP011128XP_309518.4 IG_like 30..122 CDD:214653 28/96 (29%)
Ig 32..123 CDD:299845 27/95 (28%)
IG_like 133..227 CDD:214653 28/95 (29%)
IGc2 140..218 CDD:197706 21/79 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.