DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and CEACAM20

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_011524731.1 Gene:CEACAM20 / 125931 HGNCID:24879 Length:623 Species:Homo sapiens


Alignment Length:377 Identity:82/377 - (21%)
Similarity:129/377 - (34%) Gaps:118/377 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CLIASSVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPA-----------GRNVKL 71
            ||:::|   :|...|.|        ||.         ..|:|.:|:|.           .|:|.|
Human   257 CLVSNS---ATHLSSLG--------TLK---------VRVLETLTMPQVVPSSLNLVENARSVDL 301

  Fly    72 ACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYM 136
            .|...| .|..|.|....|..:.:.|..:...|             ||..:|  .:|..|.|.|.
Human   302 TCQTVN-QSVNVQWFLSGQPLLPSEHLQLSADN-------------RTLIIH--GLQRNDTGPYA 350

  Fly   137 CQI---------NTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKW 192
            |::         ..:.....||..:|.:.......:.|: |......::||:|.|:..|....:|
Human   351 CEVWNWGSRARSEPLELTINYGPDQVHITRESASEMIST-IEAELNSSLTLQCWAESKPGAEYRW 414

  Fly   193 KRDD------GNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASN---GVPPSVSKRIKV- 247
            ..:.      |.:::|......||                |.|.|.|||   |:..|.|..:|| 
Human   415 TLEHSTGEHLGEQLIIRALTWEHD----------------GIYNCTASNSLTGLARSTSVLVKVV 463

  Fly   248 ---SVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYW-----TRENDQMITESSKYKT-E 303
               |...|     ...:.||.||....:     |..:.|.|:     .|...:..||...::| :
Human   464 GPQSSSLS-----SGAIAGIVIGILAVI-----AVASELGYFLCIRNARRPSRKTTEDPSHETSQ 518

  Fly   304 TIP--GHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPP 353
            .||  .||:..::..|      |.:|.|.        ..:.|.|::.:..||
Human   519 PIPKEEHPTEPSSESL------SPEYRNI--------SQLQGRIRVELMQPP 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 25/115 (22%)
Ig 69..139 CDD:143165 18/69 (26%)
IG_like 165..249 CDD:214653 23/96 (24%)
IGc2 172..237 CDD:197706 16/73 (22%)
IG_like 267..348 CDD:214653 18/88 (20%)
Ig 270..339 CDD:299845 15/76 (20%)
CEACAM20XP_011524731.1 Ig 96..183 CDD:299845
IG_like 97..170 CDD:214653
Ig_2 202..274 CDD:290606 8/36 (22%)
IG_like 202..274 CDD:214653 8/36 (22%)
Ig 293..370 CDD:299845 19/92 (21%)
IG_like 388..460 CDD:214653 21/88 (24%)
Ig_2 396..462 CDD:290606 19/81 (23%)
C_Hendra 499..>554 CDD:293426 14/68 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.