DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Cd86

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_006521804.1 Gene:Cd86 / 12524 MGIID:101773 Length:314 Species:Mus musculus


Alignment Length:348 Identity:69/348 - (19%)
Similarity:109/348 - (31%) Gaps:122/348 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VGLGCLIASSVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNL 78
            :||..||..:|.|.:|..|........|:.....     .||.. :||               :|
Mouse    12 MGLAILIFVTVLLISDAVSVETQAYFNGTAYLPC-----PFTKA-QNI---------------SL 55

  Fly    79 GSYKVAWMHFEQSAILTVHNHVITRNPRISVT-----HDKHDKHRTWFLHINNVQEEDRGRYMCQ 138
            ....|.|...::   |.::.|.:......||.     ....|:: .|.|.::|||.:|.|.|.|.
Mouse    56 SELVVFWQDQQK---LVLYEHYLGTEKLDSVNAKYLGRTSFDRN-NWTLRLHNVQIKDMGSYDCF 116

  Fly   139 INTVTAKTQYGFVKVVVPPN----IDDALTSSDII-------VREGDNVT------LRCKAK-GS 185
            |..             .||.    :...||...:|       ::...|||      |.|.:| |.
Mouse   117 IQK-------------KPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGH 168

  Fly   186 PEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVD 250
            |:|...:      .::.|.|.|                  .|..:.|:.:.|....|....:|:.
Mouse   169 PKPKKMY------FLITNSTNE------------------YGDNMQISQDNVTELFSISNSLSLS 209

  Fly   251 FSPMVWIPHQLVGIPIGFNITLECFIEAN---------------PTSLNYWTRENDQMITESSK- 299
            |...||            ::|:.|.:|..               |:...|| :|....:|.:.. 
Mouse   210 FPDGVW------------HMTVVCVLETESMKISSKPLNFTQEFPSPQTYW-KEITASVTVALLL 261

  Fly   300 --------YKTETIPGHPSYKAT 314
                    :|....|..||..|:
Mouse   262 VMLLIIVCHKKPNQPSRPSNTAS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 20/100 (20%)
Ig 69..139 CDD:143165 17/74 (23%)
IG_like 165..249 CDD:214653 17/97 (18%)
IGc2 172..237 CDD:197706 14/71 (20%)
IG_like 267..348 CDD:214653 13/72 (18%)
Ig 270..339 CDD:299845 13/69 (19%)
Cd86XP_006521804.1 IgV_CD86 33..138 CDD:319336 27/142 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.