DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Opcml

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:358 Identity:106/358 - (29%)
Similarity:163/358 - (45%) Gaps:43/358 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ISSFLYVGLGCLIASSVAL--STDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVK 70
            :..:|::...||:..|:.|  ...||....:|             |..|...::|:||..|.:..
  Rat     3 VCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSG-------------DATFPKAMDNVTVRQGESAT 54

  Fly    71 LACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRY 135
            |.|::.:..: :|||::  :|.||...|...:.:||:.:..:...::.   :.|.||...|.|.|
  Rat    55 LRCTIDDRVT-RVAWLN--RSTILYAGNDKWSIDPRVIILVNTPTQYS---IMIQNVDVYDEGPY 113

  Fly   136 MCQINTVT-AKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKR---DD 196
            .|.:.|.. .||....:.|.|||.|.:  .||||.|.||.:|||.|.|.|.||||:.|:.   .:
  Rat   114 TCSVQTDNHPKTSRVHLIVQVPPQIMN--ISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKE 176

  Fly   197 GNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQL 261
            |...|         .|.:.||:..|.|...|.|.|.|.|.|.....:::|::|::.|.: ...:.
  Rat   177 GQGFV---------SEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYI-SKAKN 231

  Fly   262 VGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSD 326
            .|:.:|....|.|...|.|.:...|.:|:.::.|.....:.|. .|..|     .||..||...|
  Rat   232 TGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVRIEN-KGRIS-----TLTFFNVSEKD 290

  Fly   327 YGNYKCVAKNPRGDMDGNIKLYMSSPPTTQPPP 359
            ||||.|||.|..|:.:.:|.||..||.:....|
  Rat   291 YGNYTCVATNKLGNTNASITLYEISPSSAVAGP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 26/96 (27%)
Ig 69..139 CDD:143165 18/69 (26%)
IG_like 165..249 CDD:214653 32/86 (37%)
IGc2 172..237 CDD:197706 25/67 (37%)
IG_like 267..348 CDD:214653 26/80 (33%)
Ig 270..339 CDD:299845 23/68 (34%)
OpcmlXP_017450901.1 Ig 44..132 CDD:416386 25/93 (27%)
Ig strand A' 44..49 CDD:409353 3/4 (75%)
Ig strand B 51..59 CDD:409353 2/7 (29%)
CDR1 59..63 CDD:409353 0/3 (0%)
FR2 64..70 CDD:409353 3/6 (50%)
Ig strand C 64..70 CDD:409353 3/6 (50%)
CDR2 71..83 CDD:409353 4/11 (36%)
Ig strand C' 72..76 CDD:409353 2/3 (67%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 9/36 (25%)
Ig strand D 87..94 CDD:409353 1/6 (17%)
Ig strand E 97..103 CDD:409353 0/8 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 2/8 (25%)
FR4 125..132 CDD:409353 1/6 (17%)
Ig_3 135..206 CDD:404760 32/81 (40%)
Ig strand A 135..138 CDD:409353 2/2 (100%)
Ig strand A' 144..148 CDD:409353 2/3 (67%)
Ig strand B 151..160 CDD:409353 4/8 (50%)
Ig strand C 165..170 CDD:409353 2/4 (50%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig_3 223..300 CDD:404760 25/83 (30%)
putative Ig strand A 224..230 CDD:409353 1/6 (17%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 2/8 (25%)
Ig strand F 293..298 CDD:409353 3/4 (75%)
Ig strand G 306..309 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337181
Domainoid 1 1.000 50 1.000 Domainoid score I11360
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4382
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.800

Return to query results.
Submit another query.