DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and Cntn5

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_446198.1 Gene:Cntn5 / 114589 RGDID:621302 Length:1099 Species:Rattus norvegicus


Alignment Length:461 Identity:105/461 - (22%)
Similarity:167/461 - (36%) Gaps:116/461 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PEFTDVIENITVPAG---RNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRN-PRISVTHD 112
            |.|....::|..|..   :.|.|.|.|:...|....|:                || ..|.:..|
  Rat    99 PVFVQEPDDIIFPTDSDEKKVALNCEVRGNPSPTYRWL----------------RNGTEIDLESD 147

  Fly   113 KHDKHRTWFLHINNVQE-EDRGRYMC-------QINTVTAKTQYGFVKVVVPPNIDDALTSSDII 169
            ...........|||..| .|.|.|.|       .|.:..|..|:.::     .|. ...|.|.:.
  Rat   148 YRYSMIDGTFIINNPSESRDSGLYQCLATNTFGSILSREATLQFAYL-----GNF-SGRTRSAVS 206

  Fly   170 VREGDNVTLRCK-AKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIA 233
            ||||..|.|.|. ...|||....|..::....|...:......||.:|.:.::....:|:|:|:.
  Rat   207 VREGQGVVLMCSPPPHSPEIIYSWVFNEFPSFVAEDSRRFISQETGNLYISKVQTSDVGSYICLV 271

  Fly   234 SNGV-------PPS--VSKRIKVSVDFSPMVWIPH--QLVGIPIGFNITLECFIEANPTSLNYWT 287
            .|.|       ||:  ..:...|..::.|.:.: |  ..|....|..:.:|||...||.....|.
  Rat   272 KNAVTNARVLSPPTPLTLRNDGVMGEYEPKIEV-HFPTTVTAAKGTTVKMECFALGNPVPTITWM 335

  Fly   288 RENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRG--DMDGNIKLY-- 348
            :.|..:.::|...|::.:           |.|.|:|..|.|.|:|.|:|.||  ...|.:::|  
  Rat   336 KVNGYIPSKSRLRKSQAV-----------LEIPNLQLDDAGIYECTAENSRGKNSFRGQLQIYTY 389

  Fly   349 -------------MSSP------PTTQPPPTTTTLR---------RTTTTAAEIALDGYINTPLN 385
                         ..||      .|.:|.||...|:         |..|....:|:..     :|
  Rat   390 PHWVQKLNDTQLDSGSPLQWECKATGKPRPTYRWLKNGAPLLPQSRVDTANGVLAIHS-----VN 449

  Fly   386 GNGIGI---VGEGPTNSVIASGKSSIKYLSN-----LNEIDKS------KQKLTGSSPKG----- 431
            .:..|:   :.|....::.||  :.:|.|::     ||::.||      ::.|....|:|     
  Rat   450 QSDAGMYQCLAENKYGAIYAS--AELKILASPPSFELNQVKKSIIVTKDREVLIECKPQGSPKPA 512

  Fly   432 FDWSKG 437
            ..|.||
  Rat   513 ISWRKG 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 23/107 (21%)
Ig 69..139 CDD:143165 18/78 (23%)
IG_like 165..249 CDD:214653 24/93 (26%)
IGc2 172..237 CDD:197706 17/65 (26%)
IG_like 267..348 CDD:214653 23/82 (28%)
Ig 270..339 CDD:299845 19/68 (28%)
Cntn5NP_446198.1 Ig 98..191 CDD:299845 24/107 (22%)
I-set 99..190 CDD:254352 24/106 (23%)
Ig 193..287 CDD:299845 25/99 (25%)
IG_like 205..278 CDD:214653 20/72 (28%)
Ig 300..387 CDD:299845 26/98 (27%)
I-set 300..386 CDD:254352 26/97 (27%)
I-set 390..475 CDD:254352 15/91 (16%)
Ig 392..475 CDD:299845 15/89 (17%)
I-set 480..568 CDD:254352 10/39 (26%)
Ig5_Contactin_like 496..568 CDD:143170 6/23 (26%)
I-set 573..667 CDD:254352
Ig 587..671 CDD:299845
FN3 671..768 CDD:238020
FN3 776..868 CDD:238020
FN3 878..969 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 958..983
FN3 976..1062 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.