DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and BTNL3

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_932079.1 Gene:BTNL3 / 10917 HGNCID:1143 Length:466 Species:Homo sapiens


Alignment Length:386 Identity:78/386 - (20%)
Similarity:122/386 - (31%) Gaps:151/386 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LHINNVQEEDRGRYMC----QINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREG---DNVTLR 179
            |.:.|:...|.|.|.|    ||....|..:   ::|.       ||.|..:|...|   ..:.|.
Human    99 LRLKNITPSDIGLYGCWFSSQIYDEEATWE---LRVA
-------ALGSLPLISIVGYVDGGIQLL 153

  Fly   180 CKAKG-SPEPTIKWKRDDGNKIVINKTLEVHDLETDS-----------LELERISRLHMGAYLC- 231
            |.:.| .|:||.|||...|           .||.:||           :|:..|.:.:.|:.|| 
Human   154 CLSSGWFPQPTAKWKGPQG-----------QDLSSDSRANADGYSLYDVEISIIVQENAGSILCS 207

  Fly   232 --IASNGVPPSVSKRIKV-SVDFSPMVW---------IPHQLVGIPIGFNITLECFIEAN---PT 281
              :|...  ..|..::.: ...|.|..|         :...|.|:.:|..|.   |.::.   ..
Human   208 IHLAEQS--HEVESKVLIGETFFQPSPWRLASILLGLLCGALCGVVMGMIIV---FFKSKGKIQA 267

  Fly   282 SLNYWTRENDQM-ITESSKYKTETI----PGHP---------------------SYKATMRLTIT 320
            .|: |.|::.|. :.::.|:..|..    ..||                     |.|...|.::.
Human   268 ELD-WRRKHGQAELRDARKHAVEVTLDPETAHPKLCVSDLKTVTHRKAPQEVPHSEKRFTRKSVV 331

  Fly   321 NVQSSDYGNYKC---VAKNP-------RGDMD---GNIKL-----------------------YM 349
            ..|....|.:..   |.:|.       |.|:|   .|:.|                       ::
Human   332 ASQGFQAGKHYWEVDVGQNVGWYVGVCRDDVDRGKNNVTLSPNNGYWVLRLTTEHLYFTFNPHFI 396

  Fly   350 SSPPTTQPPPTTTTLRRTTTTAAEIALDGYINTPLNGNGIGIVGEGPTNSVIASGKSSIKY 410
            |.||:|  |||..                         |:.:..||.|.|...:...|:.|
Human   397 SLPPST--PPTRV-------------------------GVFLDYEGGTISFFNTNDQSLIY 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 10/36 (28%)
Ig 69..139 CDD:143165 6/20 (30%)
IG_like 165..249 CDD:214653 24/102 (24%)
IGc2 172..237 CDD:197706 21/82 (26%)
IG_like 267..348 CDD:214653 23/145 (16%)
Ig 270..339 CDD:299845 17/107 (16%)
BTNL3NP_932079.1 Ig_MOG_like 33..132 CDD:319291 9/35 (26%)
SPRY_PRY_C-I_1 289..461 CDD:293968 29/169 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.