DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and pigrl4.2

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001293038.1 Gene:pigrl4.2 / 105665605 ZFINID:ZDB-GENE-150409-10 Length:240 Species:Danio rerio


Alignment Length:234 Identity:51/234 - (21%)
Similarity:87/234 - (37%) Gaps:73/234 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 AGNVGGSTLNNVISEDPEFTDVI--ENITVP--------------AGRNVKLACSVKNLGSYKVA 84
            ||.:...||:.|        .||  |.||:|              ...|..|.|||....::...
Zfish    15 AGTLSMKTLDRV--------PVIEGETITIPCLYDNKYKLNKKYWCNGNTWLGCSVVAYANHTGK 71

  Fly    85 WMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMC--QINTVTAKTQ 147
            |              .||..|          .|..:.:.:||....|.|.|.|  :|:.....::
Zfish    72 W--------------TITDYP----------DHNMFTVTLNNSTSSDSGHYWCAVEIDHHVDNSK 112

  Fly   148 YGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIK-W-----------KRDDGNKI 200
            |.::.|...|::  ::.||.:...:||:|::||..:.:.:..:| |           |:.|.:: 
Zfish   113 YLYLTVQKAPDV--SVLSSSVSGHKGDDVSVRCFYRSAYQNKLKQWCRIDDLTCFREKKTDTSQ- 174

  Fly   201 VINKTLEVHDLETDSLEL----ERISRLHMGAYLCIASN 235
              |.::::.|....|..:    .|:|  ..|.|.|...|
Zfish   175 --NSSVQISDDGESSFTVLMTGLRLS--DSGWYFCSVGN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 23/111 (21%)
Ig 69..139 CDD:143165 15/71 (21%)
IG_like 165..249 CDD:214653 20/87 (23%)
IGc2 172..237 CDD:197706 18/80 (23%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
pigrl4.2NP_001293038.1 IG_like 26..118 CDD:214653 25/123 (20%)
Ig_pIgR 30..117 CDD:143193 22/110 (20%)
Ig 133..217 CDD:299845 18/82 (22%)
IG_like 136..218 CDD:214653 18/79 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.