Sequence 1: | NP_001137799.1 | Gene: | DIP-epsilon / 7354433 | FlyBaseID: | FBgn0259714 | Length: | 467 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001293027.1 | Gene: | pigrl3.5 / 105665598 | ZFINID: | ZDB-GENE-150409-6 | Length: | 368 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 44/197 - (22%) |
---|---|---|---|
Similarity: | 68/197 - (34%) | Gaps: | 59/197 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 189 TIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLC---IASNGVPPSVSKRIKVSVD 250
Fly 251 FSPMVWIPHQLVGIPIGFNITLECFIEAN-PTSLNYWTRENDQMITESSKYKTETIP-------G 307
Fly 308 HPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPP-----TT--------QPPP 359
Fly 360 TT 361 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-epsilon | NP_001137799.1 | IG_like | 59..155 | CDD:214653 | |
Ig | 69..139 | CDD:143165 | |||
IG_like | 165..249 | CDD:214653 | 11/62 (18%) | ||
IGc2 | 172..237 | CDD:197706 | 9/50 (18%) | ||
IG_like | 267..348 | CDD:214653 | 21/88 (24%) | ||
Ig | 270..339 | CDD:299845 | 17/76 (22%) | ||
pigrl3.5 | NP_001293027.1 | IG_like | 27..103 | CDD:214653 | 8/44 (18%) |
Ig | 35..105 | CDD:299845 | 8/46 (17%) | ||
Ig | 135..219 | CDD:299845 | 21/91 (23%) | ||
IG_like | 137..220 | CDD:214653 | 22/90 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 40 | 1.000 | Domainoid score | I12510 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |