DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and CEACAM5

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001278413.1 Gene:CEACAM5 / 1048 HGNCID:1817 Length:702 Species:Homo sapiens


Alignment Length:474 Identity:100/474 - (21%)
Similarity:169/474 - (35%) Gaps:133/474 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ALSTDTGSEGNAGNVGGSTLNNV-ISEDPEFTDVIENITVPAGRN--VKLACSVKNLGSYKVAWM 86
            |.::|||       :..:|:..: :..:|....:..|.:.|....  |.|.|..:...:..:.| 
Human   301 AHNSDTG-------LNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWW- 357

  Fly    87 HFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQI---------NTV 142
                     |:|..:..:||:.:::|    :||  |.:.:|...|.|.|.|.|         :.|
Human   358 ---------VNNQSLPVSPRLQLSND----NRT--LTLLSVTRNDVGPYECGIQNELSVDHSDPV 407

  Fly   143 TAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLE 207
            .....||       |: |..::.|....|.|.|::|.|.|..:|.....|        :|:..::
Human   408 ILNVLYG-------PD-DPTISPSYTYYRPGVNLSLSCHAASNPPAQYSW--------LIDGNIQ 456

  Fly   208 VHDLETDSLELERISRLHMGAYLCIASN---GVPPSVSKRIKVSVDFSPMVWIPHQLVGI----P 265
            .|   |..|.:..|:..:.|.|.|.|:|   |...:..|.|.||.:      :|...:..    |
Human   457 QH---TQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAE------LPKPSISSNNSKP 512

  Fly   266 IGFN--ITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYG 328
            :...  :...|..||..|:..:|.  |.|.:..|.:.:..        .....||:.||..:|..
Human   513 VEDKDAVAFTCEPEAQNTTYLWWV--NGQSLPVSPRLQLS--------NGNRTLTLFNVTRNDAR 567

  Fly   329 NYKCVAKNP----RGDMDGNIKLYMSSPPTTQPPPTT----TTLRRTTTTAAEIA------LDGY 379
            .|.|..:|.    |.|......||....|...||.::    ..|..:..:|:..:      ::|.
Human   568 AYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGI 632

  Fly   380 IN-----------TPLNGNG-----IGIVGEGPTNSVIASGKSSIKYLSNLNEIDKSKQKLTGSS 428
            ..           || |.||     :..:..|..||::.|...|                .:|:|
Human   633 PQQHTQVLFIAKITP-NNNGTYACFVSNLATGRNNSIVKSITVS----------------ASGTS 680

  Fly   429 PKGFDWSKGKSSGSHGNLM 447
            |       |.|:|:...:|
Human   681 P-------GLSAGATVGIM 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 23/106 (22%)
Ig 69..139 CDD:143165 17/69 (25%)
IG_like 165..249 CDD:214653 23/86 (27%)
IGc2 172..237 CDD:197706 17/67 (25%)
IG_like 267..348 CDD:214653 18/86 (21%)
Ig 270..339 CDD:299845 16/72 (22%)
CEACAM5NP_001278413.1 Ig_CEACAM_D1 36..140 CDD:143251
Ig_CEACAM_D4 146..234 CDD:143217
IG_like 157..219 CDD:214653
Ig_2 240..318 CDD:290606 5/23 (22%)
IG_like 244..318 CDD:214653 5/23 (22%)
Ig_CEACAM_D4 324..412 CDD:143217 21/103 (20%)
Ig_2 418..496 CDD:290606 22/88 (25%)
IG_like 422..496 CDD:214653 22/84 (26%)
Ig 502..590 CDD:299845 19/97 (20%)
IG_like 513..589 CDD:214653 18/85 (21%)
Ig_2 596..674 CDD:290606 15/78 (19%)
IG_like 600..659 CDD:214653 10/59 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.