DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and si:dkey-182g1.10

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_005161713.1 Gene:si:dkey-182g1.10 / 101886233 ZFINID:ZDB-GENE-141216-134 Length:331 Species:Danio rerio


Alignment Length:214 Identity:52/214 - (24%)
Similarity:76/214 - (35%) Gaps:52/214 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 IIVREGDNVTL-RCKAKGSPEPTIKW---KRD---------------DGNKIVINKTLEVHDLET 213
            ::|.|||:|.| .|:.......||.|   ..|               |||:...:: ||: ||.|
Zfish    32 VLVMEGDSVPLYTCQKDTQKYETILWTYGSEDAVIAFFSRGKPFSFPDGNERFKDR-LEI-DLNT 94

  Fly   214 DSLELERISRLHMGAY-LCIASNGVPPSVSK-RIKVSVDFSPMVWIPHQLVGIPIGFNITLECFI 276
            .||.:..|...|.|.| :.:.|....|.:.: .:.||..|.|......|.| :..|.:|||...:
Zfish    95 GSLTIRNIRTNHSGVYKVDMTSTSGSPYIRRFNVTV
SAVFDPDADKIIQKV-VSEGGSITLNTDV 158

  Fly   277 EANPTSLNYW--------TRENDQMIT----------------ESSKYKTETIPGHPSYKATMRL 317
            :.....|..|        ....:.|.|                |:.|:|.......|    |..|
Zfish   159 QVQKDVLILWRFAGTKPGVYSRNSMTTICKIDGEASEEFFDHGENEKFKNRLDMDKP----TGSL 219

  Fly   318 TITNVQSSDYGNYKCVAKN 336
            .|.:::....|.||....|
Zfish   220 IIKDIRLEHSGFYKLQISN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653
Ig 69..139 CDD:143165
IG_like 165..249 CDD:214653 28/101 (28%)
IGc2 172..237 CDD:197706 25/84 (30%)
IG_like 267..348 CDD:214653 19/94 (20%)
Ig 270..339 CDD:299845 18/91 (20%)
si:dkey-182g1.10XP_005161713.1 IG_like 30..130 CDD:214653 27/99 (27%)
Ig 48..130 CDD:299845 20/83 (24%)
IG_like 145..251 CDD:214653 20/99 (20%)
Ig 148..251 CDD:299845 19/95 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.