DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and LOC101883645

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_021325225.1 Gene:LOC101883645 / 101883645 -ID:- Length:639 Species:Danio rerio


Alignment Length:375 Identity:75/375 - (20%)
Similarity:143/375 - (38%) Gaps:106/375 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 INNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALT------------SSDII----VRE 172
            :|..:||:......:.|| :.:|:       :..|:|..|.            |:|.:    |.|
Zfish    11 LNEKEEEEEEEEGAKRNT-SKRTE-------IHSNMDYVLRTVMFALVICGVFSADEVKVKSVME 67

  Fly   173 GDNVTLRCKAKGSPEPT-------IKW---KRDDG------NKIVINKTLEVHDLETDSLELERI 221
            ||:|||      :|:.|       |||   |:...      |..::...||.:|| |.||.:..:
Zfish    68 GDSVTL------NPDITQIQRINQIKWMFQKKGSNAAENIRNVEILQGRLEKNDL-TGSLTINNM 125

  Fly   222 SRLHMGAYLCIA--SNGVPPSVSKRIKVSVDFSPMVWIPH----QLVGIPIGFNITLECFI-EAN 279
            ...|.|.|....  .||   :.:....|:|:..|.|...|    :::.:..|..:.||..: |.:
Zfish   126 RTKHSGLYTLEIDHDNG---TNNASFNVTVNEVPSVIEAHKAEIKILTVKKGEPLFLETDVTEFH 187

  Fly   280 PTSLNYWTRENDQMITESSKYKTETIPGHPS---YKATMR-------LTITNVQSSDYGNYKC-V 333
            ...|..|...::..:......:|::.|.:.:   ||..::       ||:..::.:|.|.|.. :
Zfish   188 GDELIVWRFGDEGKLLAKEDKETKSSPYYNADERYKGRLQLNDQTGFLTLDKMKDTDAGYYTVRI 252

  Fly   334 AKNPRGDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTAAEIALDGYINTPLNGNGIGIVGEGPTN 398
            :.|.:                       ||.::.........:.|.:.:|..|..|.::      
Zfish   253 SSNKQ-----------------------TTYKKFAVNFTGFIISGSVVSPSAGAIIALL------ 288

  Fly   399 SVIA--SGKSSIKYLSNLNEIDKSKQKLTGSSPKGFDWSKGKSSGSHGNL 446
            .|||  :|...:.|...::|:   ::.:.|:    ..:::|:|...|..|
Zfish   289 LVIAVVAGLGVLYYRRKISEL---QEHVVGT----LKFTEGESVYLHTGL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 6/30 (20%)
Ig 69..139 CDD:143165 3/14 (21%)
IG_like 165..249 CDD:214653 29/105 (28%)
IGc2 172..237 CDD:197706 24/82 (29%)
IG_like 267..348 CDD:214653 16/92 (17%)
Ig 270..339 CDD:299845 15/80 (19%)
LOC101883645XP_021325225.1 Ig 67..152 CDD:325142 26/94 (28%)
Ig 174..263 CDD:325142 18/111 (16%)
Ig 320..418 CDD:325142 4/12 (33%)
Ig 427..517 CDD:325142
Ig 530..621 CDD:325142
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.