| Sequence 1: | NP_001137799.1 | Gene: | DIP-epsilon / 7354433 | FlyBaseID: | FBgn0259714 | Length: | 467 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031761715.1 | Gene: | ceacam8l / 101730286 | XenbaseID: | XB-GENE-22169429 | Length: | 407 | Species: | Xenopus tropicalis |
| Alignment Length: | 305 | Identity: | 63/305 - (20%) |
|---|---|---|---|
| Similarity: | 115/305 - (37%) | Gaps: | 40/305 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 52 PEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRI-SVTH-DKH 114
Fly 115 DKHRTWF----LHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDN 175
Fly 176 VTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPS 240
Fly 241 VSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETI 305
Fly 306 PGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMS 350 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-epsilon | NP_001137799.1 | IG_like | 59..155 | CDD:214653 | 17/101 (17%) |
| Ig | 69..139 | CDD:143165 | 13/75 (17%) | ||
| IG_like | 165..249 | CDD:214653 | 24/83 (29%) | ||
| IGc2 | 172..237 | CDD:197706 | 22/64 (34%) | ||
| IG_like | 267..348 | CDD:214653 | 14/80 (18%) | ||
| Ig | 270..339 | CDD:299845 | 13/68 (19%) | ||
| ceacam8l | XP_031761715.1 | Ig | 29..132 | CDD:416386 | 19/107 (18%) |
| FR1 | 30..48 | CDD:409353 | 3/12 (25%) | ||
| Ig strand A | 30..32 | CDD:409353 | |||
| Ig strand A' | 37..39 | CDD:409353 | 0/1 (0%) | ||
| Ig strand B | 42..49 | CDD:409353 | 1/9 (11%) | ||
| CDR1 | 49..56 | CDD:409353 | 0/6 (0%) | ||
| FR2 | 57..62 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C | 57..61 | CDD:409353 | 0/3 (0%) | ||
| CDR2 | 63..84 | CDD:409353 | 4/20 (20%) | ||
| Ig strand C' | 71..76 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 81..84 | CDD:409353 | 2/2 (100%) | ||
| FR3 | 91..117 | CDD:409353 | 6/25 (24%) | ||
| Ig strand D | 91..96 | CDD:409353 | 1/4 (25%) | ||
| Ig strand E | 98..102 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 112..117 | CDD:409353 | 1/4 (25%) | ||
| CDR3 | 118..124 | CDD:409353 | 1/5 (20%) | ||
| FR4 | 125..132 | CDD:409353 | 1/6 (17%) | ||
| Ig strand G | 125..131 | CDD:409353 | 1/5 (20%) | ||
| Ig | 139..222 | CDD:416386 | 24/88 (27%) | ||
| Ig strand A | 139..142 | CDD:409353 | 0/2 (0%) | ||
| Ig strand A' | 145..150 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 154..160 | CDD:409353 | 4/5 (80%) | ||
| Ig strand C | 166..171 | CDD:409353 | 2/5 (40%) | ||
| Ig strand C' | 173..176 | CDD:409353 | 0/2 (0%) | ||
| Ig strand D | 178..182 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 185..190 | CDD:409353 | 1/4 (25%) | ||
| Ig strand F | 200..208 | CDD:409353 | 4/7 (57%) | ||
| Ig strand G | 212..221 | CDD:409353 | 1/8 (13%) | ||
| Ig strand A' | 233..236 | CDD:409353 | 0/2 (0%) | ||
| Ig_3 | 236..291 | CDD:404760 | 13/71 (18%) | ||
| Ig strand B | 241..249 | CDD:409353 | 3/7 (43%) | ||
| Ig strand C | 255..259 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 262..265 | CDD:409353 | 0/2 (0%) | ||
| Ig strand E | 270..275 | CDD:409353 | 1/4 (25%) | ||
| Ig strand F | 283..291 | CDD:409353 | 4/7 (57%) | ||
| Ig strand G | 294..304 | CDD:409353 | 0/9 (0%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||