DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and SPEGNB

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001273740.1 Gene:SPEGNB / 100996693 HGNCID:51251 Length:238 Species:Homo sapiens


Alignment Length:210 Identity:54/210 - (25%)
Similarity:76/210 - (36%) Gaps:56/210 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRD-----DGNKI--------VINKTLE 207
            ||.:.:.|  .|:::.||....|.|:....|:|.|:|.:|     ||.|.        |:  .|.
Human    53 PPRVLEPL--KDVVLIEGSAAKLTCRISAFPDPFIRWSKDGKELRDGPKYRYVFEDPDVV--ALV 113

  Fly   208 VHDLETDSLELERISRLHMGAYLCIASNGVPP----SVSKRIKVSVDFSPMVWIPHQLVGIP--- 265
            |.|.|...|          |.|....:|   |    |.|.||        :|.:|.::...|   
Human   114 VRDGELADL----------GQYSINVTN---PFGQCSDSARI--------LVEVPTKIQKGPDNT 157

  Fly   266 ---IGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDY 327
               .|..:||...|...|.....||::.:. |.|..:...|.      ...|..|||......|.
Human   158 KARKGTTVTLTAEILGEPAPDVGWTKDGED-IEEDDRVFFEI------GSTTTTLTIRRATPQDS 215

  Fly   328 GNYKCVAKNPRGDMD 342
            |.|:...:|..| ||
Human   216 GKYEVYVENSLG-MD 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653
Ig 69..139 CDD:143165
IG_like 165..249 CDD:214653 27/100 (27%)
IGc2 172..237 CDD:197706 21/77 (27%)
IG_like 267..348 CDD:214653 21/76 (28%)
Ig 270..339 CDD:299845 17/68 (25%)
SPEGNBNP_001273740.1 IQ 27..49 CDD:197470
I-set 54..144 CDD:369462 29/114 (25%)
I-set 149..237 CDD:369462 22/89 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.