DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and igsf9b

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_031761656.1 Gene:igsf9b / 100379858 XenbaseID:XB-GENE-5887265 Length:1392 Species:Xenopus tropicalis


Alignment Length:523 Identity:115/523 - (21%)
Similarity:187/523 - (35%) Gaps:132/523 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YHLEAISSFLYVGLGCLIASSVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGR 67
            |.|..|:|         :.|::.||..        ..|||      .|:|:|      :|..||.
 Frog     4 YVLTLIAS---------VISTLGLSVQ--------GAGGS------REEPQF------VTARAGE 39

  Fly    68 NVKLACSVKN-----LGSYKVAWMHFEQSAILTVH-----NHVITRNPRISVTHDKHDKHRTWFL 122
            :|.|.|.|.:     ...|.|.|..|.....:.:.     .||.......:..:||..      |
 Frog    40 SVILGCDVVHPLTVQPPPYVVEWFKFGVPIPIFIKFGFYPPHVDPEYVGRAALYDKAS------L 98

  Fly   123 HINNVQEEDRGRYMCQINTVTAKTQY------GFVKVVV--PPNIDDALTSSDIIVREGDNVTLR 179
            .|..|:.:|:|.|.|::  :..:.||      .:|.:.|  ||...:. ....:.|:||.::||.
 Frog    99 RIEQVRSQDQGWYECKV--LMLEHQYDTFHNGSWVHLTVNAPPTFTET-PPQYLEVKEGSSITLT 160

  Fly   180 CKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKR 244
            |.|.|:|:||:.|.|:..   .:.:|.: :.|...||.:..|.|...|:|:|.|:: :.......
 Frog   161 CTAFGNPKPTVSWLREGE---FLGRTSK-YQLSDGSLTISSIGREDRGSYMCRATS-IQGEAVHS 220

  Fly   245 IKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLN---YWTRENDQMITESSKYKTETIP 306
            .::.|..||.:..|.:.:.:.|..:....|..||.|.:|.   ||..||.....:........|.
 Frog   221 TRLLVQGSPFIVSPPENITVNISQDALFTCQAEAYPGNLTYTWYWQEENVFFKNDLKLRVRILID 285

  Fly   307 GHPSYKATMRLTITNVQSSDYGNYKCVAKNPRG----------------------------DMDG 343
            |        .|.|..|:..|.|.|.||..|..|                            .:.|
 Frog   286 G--------TLIIFRVKPEDAGKYTCVPSNSLGRSPSASAYLTVQYPARVVNMPPVIYVPVGIHG 342

  Fly   344 NIKLYMSSPPTTQPPPTT--------TTLRRTTTTAAEIALDGYIN------------TPLNGNG 388
            :|:.     |....||.|        ..||....:..::..||.|:            |.:..|.
 Frog   343 HIRC-----PVEAVPPVTFVKWNKDGRPLRIDKFSGWKLLDDGTIHVEEATEELLGTYTCVPYNA 402

  Fly   389 IGIVGEGPTNSVIASGKSSIKYLSNLNEIDKSKQKL------TGSSPKGFDWSK-GKSSGSHGNL 446
            :|.:|:.|...::.........|.......::.::|      .|.......|.| |:.|.|..::
 Frog   403 LGTMGQSPPARLLLKDPPYFTVLPGWEYRQEAGRELLIPCAAAGDPFPSISWRKVGRPSFSKHSV 467

  Fly   447 MAS 449
            :.|
 Frog   468 LPS 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 25/111 (23%)
Ig 69..139 CDD:143165 19/79 (24%)
IG_like 165..249 CDD:214653 23/83 (28%)
IGc2 172..237 CDD:197706 22/64 (34%)
IG_like 267..348 CDD:214653 23/111 (21%)
Ig 270..339 CDD:299845 20/71 (28%)
igsf9bXP_031761656.1 IG 30..115 CDD:214652 24/96 (25%)
I-set 139..225 CDD:400151 24/91 (26%)
Ig strand A 139..142 CDD:409353 1/2 (50%)
Ig strand A' 148..151 CDD:409353 0/2 (0%)
Ig strand B 157..164 CDD:409353 3/6 (50%)
Ig strand C 170..175 CDD:409353 2/4 (50%)
Ig strand D 185..189 CDD:409353 0/4 (0%)
Ig strand E 191..195 CDD:409353 2/3 (67%)
Ig strand F 204..212 CDD:409353 4/7 (57%)
Ig strand G 215..225 CDD:409353 0/9 (0%)
I-set 229..321 CDD:400151 24/99 (24%)
Ig strand B 246..250 CDD:409353 0/3 (0%)
Ig strand C 260..264 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/11 (18%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
Ig strand G 314..317 CDD:409353 0/2 (0%)
Ig 344..405 CDD:409353 12/65 (18%)
Ig strand C 355..360 CDD:409353 1/4 (25%)
Ig strand E 380..384 CDD:409353 2/3 (67%)
Ig strand F 394..399 CDD:409353 1/4 (25%)
Ig 429..505 CDD:416386 8/42 (19%)
Ig strand A' 429..432 CDD:409353 0/2 (0%)
Ig strand B 438..445 CDD:409353 1/6 (17%)
Ig strand C 451..456 CDD:409353 1/4 (25%)
Ig strand C' 458..460 CDD:409353 1/1 (100%)
Ig strand E 471..476 CDD:409353 115/523 (22%)
Ig strand F 484..492 CDD:409353
Ig strand G 495..505 CDD:409353
FN3 510..605 CDD:238020
FN3 622..703 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.