DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and adgrl1.1

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_002660669.2 Gene:adgrl1.1 / 100334775 ZFINID:ZDB-GENE-130116-2 Length:390 Species:Danio rerio


Alignment Length:174 Identity:41/174 - (23%)
Similarity:60/174 - (34%) Gaps:52/174 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DKHRTWFLHINNVQEEDRGR-YMCQINTVTAK----TQYGFVKVVVPPNI--------------- 159
            |:|..|.::   ..|.:.|| .:.|:|..|.:    .|..|.|.:.....               
Zfish   203 DEHGLWVIY---TTEANNGRLVVSQVNPYTLRFEGTWQTSFEKRMASDAFVACGILYAVRSVYQD 264

  Fly   160 DDALTSSDIIVREGDNVTLRCKAKGSPEP-------TIKWK-RDD-----GNKIVINKTLEVHDL 211
            ||:....|:|:...|....|.:....|.|       :|.:. ||:     .|.||:...||....
Zfish   265 DDSEAGGDLILYAYDTRRNREEPVRIPFPNPYQHISSISYNPRDNQLYVWNNYIVLRYPLEFSPP 329

  Fly   212 E--TDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSP 253
            :  ||.|....:|.             .||| |....||:.|||
Zfish   330 QPTTDPLSTPLLST-------------TPPS-SLSSTVSMGFSP 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 12/44 (27%)
Ig 69..139 CDD:143165 6/24 (25%)
IG_like 165..249 CDD:214653 23/98 (23%)
IGc2 172..237 CDD:197706 16/79 (20%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
adgrl1.1XP_002660669.2 OLF 72..328 CDD:295358 28/127 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.