DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and LOC100332092

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_021322078.1 Gene:LOC100332092 / 100332092 -ID:- Length:330 Species:Danio rerio


Alignment Length:234 Identity:52/234 - (22%)
Similarity:92/234 - (39%) Gaps:36/234 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 SLELERISRLHMGAYLCIASNGVPPSVSKR--IKVSVDFSPMVWIPHQLVGIPIGFNITLECFIE 277
            ::|.:.:.......|.|....|.|.::...  :.::|..:|.|.:....|....|.|::::|...
Zfish    79 TVEWQNLQPSDSAYYWCAVEIGG
PGTLDAGYFLYLTVQSAPDVSVKSSSVSGHEGGNVSVQCLYR 143

  Fly   278 ANPTSLN-YWTRENDQ-MITESSKYKTET-----IPGHPSYKATMRLTITNVQSSDYGNYKCVAK 335
            :...:.| .|.|..|: ..||.   ||:|     :......|:...:.:|.:..||.|.|.|.. 
Zfish   144 SGYKTYNKQWCRVKDKSCFTEE---KTDTSQNLSVQISDDGKSFFTVLMTGLNLSDSGWYFCSV- 204

  Fly   336 NPRGDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTAAEIALDGYINTPLNGNGIGIVGEGPTNSV 400
               ||:...::|.::.|    .|...||.:.|:.|...       .|.|:.|....:    .:|.
Zfish   205 ---GDLQVPVQLTVTKP----EPKVLTTPKYTSETEMN-------TTQLSNNTTSTI----MHST 251

  Fly   401 IASGKSSIKY----LSNLNEIDKSKQKLTGSSPKGFDWS 435
            |..|:...|.    .|.:|.: .|:.::|..||...|.|
Zfish   252 INKGEQIKKEERVDSSTMNTM-PSENQMTSISPAEADSS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653
Ig 69..139 CDD:143165
IG_like 165..249 CDD:214653 5/35 (14%)
IGc2 172..237 CDD:197706 3/21 (14%)
IG_like 267..348 CDD:214653 21/87 (24%)
Ig 270..339 CDD:299845 17/75 (23%)
LOC100332092XP_021322078.1 Ig 30..101 CDD:325142 3/21 (14%)
Ig 130..214 CDD:325142 21/90 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.