DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and si:ch73-213k20.5

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_017208962.1 Gene:si:ch73-213k20.5 / 100329262 ZFINID:ZDB-GENE-120727-11 Length:406 Species:Danio rerio


Alignment Length:345 Identity:77/345 - (22%)
Similarity:121/345 - (35%) Gaps:90/345 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVH---NHVITRNPRISVTHDKHDK---- 116
            ::::|..|.:|.|...||....|.:.|: :|...|..:.   :::.|.....:.|....|:    
Zfish    26 DDVSVSRGDSVTLHTGVKTNQQYIIVWL-YEGIRIAVIRGDLSYICTDVQCNNGTERFRDRLKLD 89

  Fly   117 HRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNI---DDALTSSDIIVREGDNVTL 178
            |.|..|.:.|.:..|.|.|...|::..:..:..| :|||....   :|......:.|.|||:|||
Zfish    90 HLTGSLTVMNTRLRDAGEYQLLISSSKSINEMIF-RVVVKDVYWVDEDDNDEESVSVIEGDSVTL 153

  Fly   179 RCKAKGSPEPTIKWKRDDGNKIVINKTLEV-------------------HDLETDSLELERISRL 224
            ....|...:..|.|..:.....||:..|.|                   .|.:|.||.:......
Zfish   154 HTGVKTDQQDRIVWFNEGSRVAVISGDLNVICTDVQCDNSTTRFKNRLNLDHQTGSLTIMNSRNT 218

  Fly   225 HMGAY-LCIASNGVPPSVSKRIKVSVDFSPMV----WIPHQLVGIPI--GFNITLECFIEANPTS 282
            ..|.| |.|.|:.   .:||:|     |..:|    |:....|.:.:  |:::||          
Zfish   219 DAGEYQLLIFSSF---RLSKKI-----FRVVVHDVHWVQEVKVEVSVTDGYSVTL---------- 265

  Fly   283 LNYWTRENDQMITESSKYK-------TETIPGHPSY---------------------KATMRLTI 319
                  ..|....:..|.|       ...|.|..||                     ..|..|||
Zfish   266 ------NTDTTTKQLHKIKWYFNNICVAQIRGDLSYICTDVQCDEGAERFGDRLKLDHQTGSLTI 324

  Fly   320 TNVQSSDYGNYKCVAKNPRG 339
            .|:::.|.|.||....:.||
Zfish   325 MNIRNRDRGEYKLEIISNRG 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 23/102 (23%)
Ig 69..139 CDD:143165 18/76 (24%)
IG_like 165..249 CDD:214653 26/103 (25%)
IGc2 172..237 CDD:197706 22/84 (26%)
IG_like 267..348 CDD:214653 21/101 (21%)
Ig 270..339 CDD:299845 18/96 (19%)
si:ch73-213k20.5XP_017208962.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.