DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and btn2a1

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_012808960.1 Gene:btn2a1 / 100170443 XenbaseID:XB-GENE-6459012 Length:347 Species:Xenopus tropicalis


Alignment Length:320 Identity:52/320 - (16%)
Similarity:103/320 - (32%) Gaps:144/320 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LACSV-KNLGSYKVAWMHFE------------QSAILTVHNHVITRNPRISVTHDKHDKHRTWF- 121
            :||:: |.:.::.:.|..::            .|.:.|:.:.|:. ..|::...:.......|| 
 Frog     1 MACNMHKTMIAFSILWSLYKGSLSAKYKVVSAPSVVATLGSDVVL-TARLAPEMNAEKMEIRWFK 64

  Fly   122 --------LHIN---------------------------------NVQEEDRGRYMCQINTVTAK 145
                    |:||                                 ||..:|.|:|.|.   |.:.
 Frog    65 PMYRPYVHLYINGKDDYTAQMPQFANRTELLKENITRGIFPLIIRNVTVQDSGKYYCY---VESS 126

  Fly   146 TQYGFVKVVVPPNI-------------------------------------DDALTSSDIIVREG 173
            ..:|...|.:..|:                                     :.|:.|..:|....
 Frog   127 DHHGITTVYLNVNVPGHSKTHSHKESGVRIPRDVSINQERQSQAQRSDSPKEGAVGSPPVISVIT 191

  Fly   174 DNVTLRCKAKG-SPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGV 237
            |: |:.|::.| .|||.:.|..::|||::.:              :|::.:.....|..:::..:
 Frog   192 DD-TVFCESDGWYPEPYLIWTDNEGNKVIPS--------------MEKVLKDEKSLYHILSAIYL 241

  Fly   238 PPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITES 297
            ||:.|                          |||  |.:.   :|||. ::|:...|.|:
 Frog   242 PPTSS--------------------------NIT--CTVS---SSLNQ-SKESSMQIRET 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 22/138 (16%)
Ig 69..139 CDD:143165 19/122 (16%)
IG_like 165..249 CDD:214653 18/84 (21%)
IGc2 172..237 CDD:197706 13/65 (20%)
IG_like 267..348 CDD:214653 10/31 (32%)
Ig 270..339 CDD:299845 9/28 (32%)
btn2a1XP_012808960.1 Ig 40..138 CDD:386229 16/101 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.