Sequence 1: | NP_001137799.1 | Gene: | DIP-epsilon / 7354433 | FlyBaseID: | FBgn0259714 | Length: | 467 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012808960.1 | Gene: | btn2a1 / 100170443 | XenbaseID: | XB-GENE-6459012 | Length: | 347 | Species: | Xenopus tropicalis |
Alignment Length: | 320 | Identity: | 52/320 - (16%) |
---|---|---|---|
Similarity: | 103/320 - (32%) | Gaps: | 144/320 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 LACSV-KNLGSYKVAWMHFE------------QSAILTVHNHVITRNPRISVTHDKHDKHRTWF- 121
Fly 122 --------LHIN---------------------------------NVQEEDRGRYMCQINTVTAK 145
Fly 146 TQYGFVKVVVPPNI-------------------------------------DDALTSSDIIVREG 173
Fly 174 DNVTLRCKAKG-SPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGV 237
Fly 238 PPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITES 297 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-epsilon | NP_001137799.1 | IG_like | 59..155 | CDD:214653 | 22/138 (16%) |
Ig | 69..139 | CDD:143165 | 19/122 (16%) | ||
IG_like | 165..249 | CDD:214653 | 18/84 (21%) | ||
IGc2 | 172..237 | CDD:197706 | 13/65 (20%) | ||
IG_like | 267..348 | CDD:214653 | 10/31 (32%) | ||
Ig | 270..339 | CDD:299845 | 9/28 (32%) | ||
btn2a1 | XP_012808960.1 | Ig | 40..138 | CDD:386229 | 16/101 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |