DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and lrig3

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_002940426.3 Gene:lrig3 / 100151727 XenbaseID:XB-GENE-1219309 Length:1109 Species:Xenopus tropicalis


Alignment Length:313 Identity:76/313 - (24%)
Similarity:120/313 - (38%) Gaps:18/313 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDK 116
            |:.|...|..:...|.||...||..:.....:.:...:.:.:|  |:..|.....:.....:..:
 Frog   494 PQITVQPETQSAIKGSNVTFICSAASSSESPMTFAWKKDNELL--HDSEIENYAHLRAQGGEVME 556

  Fly   117 HRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTS--SDIIVREGDNVTLR 179
            :.| .|.:.||:..:.|:|.|.|:.....| |. ||..:..|:....|.  .|:.:|.|....|.
 Frog   557 YTT-ILRLRNVEFINEGKYQCVISNHFGPT-YS-VKAKLTVNMLPLFTKMPMDLTIRAGSTARLE 618

  Fly   180 CKAKGSPEPTIKWKRDDGNKIVINKTLEVHDL-ETDSLELERISRLHMGAYLCIASNGVPPSVSK 243
            |.|.|.|.|.|.|:::.|......:...:|.: |.|...:..:....:|.|.|.|.|.. .|:|.
 Frog   619 CAAVGHPTPQIAWQKNGGTDFPAARERRMHVMPEDDVFFIVNVKTEDIGVYSCTAQNSA-GSISA 682

  Fly   244 RIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGH 308
            ...::|..:|....|........|....|:|....:||....||:::..::.      ||.   |
 Frog   683 NATLTVLETPSFLRPLVDRTASKGETTVLQCIAGGSPTPKVNWTKDDSPLVV------TER---H 738

  Fly   309 PSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQPPPTT 361
            ........|.|.:....|.|.|.|...|..|...|||.|.:...||...|..|
 Frog   739 FFAAGNQHLIIVDTDLEDAGKYTCEVSNILGTERGNIHLSVLPNPTCDSPVNT 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 21/95 (22%)
Ig 69..139 CDD:143165 13/69 (19%)
IG_like 165..249 CDD:214653 22/86 (26%)
IGc2 172..237 CDD:197706 18/65 (28%)
IG_like 267..348 CDD:214653 21/80 (26%)
Ig 270..339 CDD:299845 16/68 (24%)
lrig3XP_002940426.3 LRRNT 40..67 CDD:214470
leucine-rich repeat 52..69 CDD:275380
LRR <58..>243 CDD:227223
internalin_A 70..>437 CDD:380193
leucine-rich repeat 73..93 CDD:275380
leucine-rich repeat 94..140 CDD:275380
leucine-rich repeat 141..163 CDD:275380
leucine-rich repeat 164..187 CDD:275380
leucine-rich repeat 189..211 CDD:275380
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380
leucine-rich repeat 260..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..331 CDD:275380
leucine-rich repeat 332..355 CDD:275380
leucine-rich repeat 356..380 CDD:275380
leucine-rich repeat 383..406 CDD:275380
leucine-rich repeat 407..428 CDD:275380
PCC 411..>489 CDD:188093
Ig_3 493..580 CDD:404760 19/88 (22%)
Ig strand A 494..497 CDD:409353 1/2 (50%)
Ig strand A' 500..505 CDD:409353 1/4 (25%)
Ig strand B 511..519 CDD:409353 3/7 (43%)
Ig strand C 526..531 CDD:409353 0/4 (0%)
Ig strand C' 533..535 CDD:409353 0/1 (0%)
Ig strand D 552..555 CDD:409353 0/2 (0%)
Ig strand E 559..565 CDD:409353 2/6 (33%)
Ig strand F 572..579 CDD:409353 3/6 (50%)
Ig strand G 586..594 CDD:409353 3/8 (38%)
IgI_LRIG1-like 600..689 CDD:409420 23/89 (26%)
Ig strand B 615..619 CDD:409420 1/3 (33%)
Ig strand C 628..632 CDD:409420 1/3 (33%)
Ig strand E 654..658 CDD:409420 1/3 (33%)
Ig strand F 668..673 CDD:409420 2/4 (50%)
Ig strand G 681..684 CDD:409420 1/2 (50%)
I-set 692..779 CDD:400151 24/95 (25%)
Ig strand A 693..695 CDD:409353 0/1 (0%)
Ig strand A' 700..704 CDD:409353 0/3 (0%)
Ig strand B 707..714 CDD:409353 1/6 (17%)
Ig strand C 721..727 CDD:409353 1/5 (20%)
Ig strand C' 728..730 CDD:409353 0/1 (0%)
Ig strand D 737..740 CDD:409353 1/5 (20%)
Ig strand E 743..751 CDD:409353 2/7 (29%)
Ig strand F 758..766 CDD:409353 3/7 (43%)
Ig strand G 770..779 CDD:409353 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.