DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and si:ch211-9d9.7

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_021322083.1 Gene:si:ch211-9d9.7 / 100150985 ZFINID:ZDB-GENE-060503-422 Length:288 Species:Danio rerio


Alignment Length:184 Identity:45/184 - (24%)
Similarity:72/184 - (39%) Gaps:25/184 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 IIVREGDNVTLRC--KAKGSPEPTIKWKRDDGNKIVINKT---LEVHDLETDSLELERISRL--- 224
            |.|:.|.:||:.|  ..|..|:....:.....::...|.|   |.|.|....||....:..|   
Zfish    77 ITVKPGGSVTIPCYYDEKNPPQKKYWYSVIGESRKYTNTTEENLSVIDHPDQSLFTVTMRNLQEN 141

  Fly   225 -HMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEAN-PTSLNYWT 287
             |.|.|.|....|...:|:..:.:.|..:|.|.:.:..|....|.:::::||..:. ......|.
Zfish   142 KHNGKYYCTVETGQKSNVTYELFLQVH
SAPDVSVMNSSVSGHEGDDVSVQCFYSSGYKDKQKRWC 206

  Fly   288 RENDQMITESSKYKTETI---------PGHPSYKATMRLTITNVQSSDYGNYKC 332
            |..||..  .|:.||:|.         .|..|:...|    |.::.||.|.:.|
Zfish   207 RYKDQKC--FSQKKTDTSQSSSVQISDDGESSFTVLM----TGLRLSDSGWFFC 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653
Ig 69..139 CDD:143165
IG_like 165..249 CDD:214653 22/89 (25%)
IGc2 172..237 CDD:197706 18/73 (25%)
IG_like 267..348 CDD:214653 19/76 (25%)
Ig 270..339 CDD:299845 18/73 (25%)
si:ch211-9d9.7XP_021322083.1 Ig 76..168 CDD:325142 22/90 (24%)
Ig 180..266 CDD:325142 20/81 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.