DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and si:ch211-66e2.5

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_001920347.3 Gene:si:ch211-66e2.5 / 100150500 ZFINID:ZDB-GENE-131121-180 Length:302 Species:Danio rerio


Alignment Length:246 Identity:59/246 - (23%)
Similarity:93/246 - (37%) Gaps:68/246 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LNNVISEDPEFTDV-IENITVPA--GRNVKLACSVKNLG--SYKVAWMHFEQSAILTVHNHVITR 103
            ||.|:.:.|:...: :.|.:.|.  ||..:|.|.|.|:.  .|.|...:.||:   .|:||..:.
Zfish   100 LNLVLYKKPDSVSISLVNHSSPVVEGREYQLQCEVHNVAPVQYLVLRWYREQT---EVYNHSFSE 161

  Fly   104 ----NP-RISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYG-------------- 149
                .| ::|.|          .|.:.| :.||..:|.|:     |:.|.|              
Zfish   162 LTPATPVQVSST----------LLIVPN-RAEDGAQYRCE-----AELQLGPEGPQPPPTVLSPS 210

  Fly   150 -FVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLET 213
             .:.|..||:.... ....:.|.||..|.|.|.|:|:|.|...|...:..:            :.
Zfish   211 LNIAVHYPPDFRSP-KEEQLEVSEGSEVVLDCTAEGNPLPVYIWTSPNLQE------------KA 262

  Fly   214 DSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGI 264
            |...:.:.:.|..|.|.|.|||    .:.|:.|..|       |.|:..|:
Zfish   263 DDQPVLKDASLSPGVYTCTASN----ILGKKSKQFV-------IKHKSKGV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 28/119 (24%)
Ig 69..139 CDD:143165 20/76 (26%)
IG_like 165..249 CDD:214653 21/83 (25%)
IGc2 172..237 CDD:197706 18/64 (28%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
si:ch211-66e2.5XP_001920347.3 Ig 108..203 CDD:299845 28/113 (25%)
IG_like 122..196 CDD:214653 24/92 (26%)
IG_like 227..293 CDD:214653 21/81 (26%)
Ig_2 227..284 CDD:290606 17/68 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.