DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and lrfn4b

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_021333806.1 Gene:lrfn4b / 100149980 ZFINID:ZDB-GENE-070705-473 Length:1131 Species:Danio rerio


Alignment Length:277 Identity:49/277 - (17%)
Similarity:84/277 - (30%) Gaps:105/277 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 DRG-----RY---MCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSP- 186
            |||     |:   .|::...||....||..   ..|......:.|:      ..||||.|..:| 
Zfish   839 DRGPQFLSRFWGAFCRLFGTTASLSSGFHP---ESNGQTERVNQDL------ETTL
RCMAANNPT 894

  Fly   187 --EPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSV 249
              ...|.|.....|.:..:.|                              |:.|     .:...
Zfish   895 TWSSYIMWAEYAHNTLKSSAT------------------------------GLSP-----FECQF 924

  Fly   250 DFSPMVWIPHQL-VGIPIGFNITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGH---PS 310
            .::|.::...:: ||:|...:....|        ...|.|....::..|.:|:.:.....   |:
Zfish   925 GYTPPLFPEKEVQVGVPSAQHFVRRC--------RRTWRRARSALLRTSLRYQHQANRRRRRPPT 981

  Fly   311 YKATMRLTIT------NVQSSD-----YGNYKCVAK-NPRGDMDGNIKLY--------------- 348
            ::...|:.:.      .|:|..     .|.::...| ||     .:.:||               
Zfish   982 FRVGQRVWLATKNLPLRVESRKLSQRFIGPFRIARKVNP-----VSYRLYLPRSLRINPTFHVSL 1041

  Fly   349 ----MSSP--PTTQPPP 359
                :|||  |..:|||
Zfish  1042 LKPVLSSPFAPPRRPPP 1058

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 9/31 (29%)
Ig 69..139 CDD:143165 5/15 (33%)
IG_like 165..249 CDD:214653 13/86 (15%)
IGc2 172..237 CDD:197706 10/67 (15%)
IG_like 267..348 CDD:214653 13/95 (14%)
Ig 270..339 CDD:299845 13/83 (16%)
lrfn4bXP_021333806.1 retropepsin_like 58..144 CDD:133136
RT_LTR 253..429 CDD:238825
RNase_HI_RT_Ty3 525..646 CDD:260006
zf-H2C2 716..749 CDD:324145
rve 772..885 CDD:307008 11/54 (20%)
Chromo 1069..1116 CDD:306815
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10955
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.