DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and si:ch211-209l18.4

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_001923591.2 Gene:si:ch211-209l18.4 / 100149940 ZFINID:ZDB-GENE-110411-221 Length:348 Species:Danio rerio


Alignment Length:325 Identity:69/325 - (21%)
Similarity:124/325 - (38%) Gaps:89/325 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHD 112
            ||.||:....:|:      .:|.|....:......:.| :|....|..::...|:..|..:..:|
Zfish    35 ISIDPDTVSAMED------DSVTLHIDTETNQHDDIRW-YFNGIRIAQIYRDGISICPGDNCEND 92

  Fly   113 --------KHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVV----VPPNIDDALTS 165
                    |.|| :|.:|.|.|:..:|.|:|:.:|  :.....|..:.:|    ||.|:..:   
Zfish    93 TERFKDRLKLDK-QTGYLTIMNIGNKDAGKYILKI--IQTNDIYDRIFIVTFIGVPGNVSAS--- 151

  Fly   166 SDIIVREGDNVTLRCKAKGSPEPTIKW---------------------KRDDGNKIVINKTLEVH 209
                |:||.:||:....|.:.:..:||                     :.:|||:...:: |:: 
Zfish   152 ----VKEGHSVTVNTDVKRNQQKYVKWILNNITIAQINGDLGYTCTDVQCNDGNQRFKDR-LKL- 210

  Fly   210 DLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFS------PMVWIPHQLVGIPIGF 268
            |.:|.||.:...|....|.|....:|.. .|:.:|..|:|..|      |.|.: :.|:.:.:  
Zfish   211 DNQTGSLTIMNTSTADSGDYYLEINNNT-FSIMRRFSVNVTDSAHPEEGPAVTV-YVLIAVTV-- 271

  Fly   269 NITLECFIEANPTSLNYW------------TRENDQMITESSKYKTE-----------TIPGHPS 310
             ..|.........::.||            |.|.|   |:.:..|:|           .:.|:||
Zfish   272 -YVLIAVAVVGAAAILYWKCCKSSKQNGNGTEEQD---TKMNSVKSELLYSGQNAAANEVSGNPS 332

  Fly   311  310
            Zfish   333  332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 22/107 (21%)
Ig 69..139 CDD:143165 18/77 (23%)
IG_like 165..249 CDD:214653 23/104 (22%)
IGc2 172..237 CDD:197706 19/85 (22%)
IG_like 267..348 CDD:214653 12/67 (18%)
Ig 270..339 CDD:299845 12/64 (19%)
si:ch211-209l18.4XP_001923591.2 IG_like 39..>123 CDD:214653 19/91 (21%)
Ig 48..135 CDD:299845 20/90 (22%)
IG_like 145..249 CDD:214653 25/113 (22%)
Ig 154..249 CDD:299845 22/97 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.