DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and si:ch211-74m13.1

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_001922015.4 Gene:si:ch211-74m13.1 / 100149459 ZFINID:ZDB-GENE-081104-12 Length:328 Species:Danio rerio


Alignment Length:349 Identity:73/349 - (20%)
Similarity:124/349 - (35%) Gaps:99/349 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRG 133
            |.|..:||  |:.....:......::...|...:.|...|||||    ...|...:..|.     
Zfish    12 VTLLVTVK--GTNAECPLQINPPKLVVRFNSSASANCNTSVTHD----GMGWEATVGGVP----- 65

  Fly   134 RYMCQINTVTAKT---------------QYG-FVKVVVPPNI---DDALTSSDI--IVREGDNVT 177
              :.:.|.:|.:.               .|| ..:|.:|..|   .|:::.|.:  |:.||:...
Zfish    66 --LSKANLITWRVSQLTDWKIEPPFCYINYGKQCEVPLPVTIYKTPDSVSISTVNQIMTEGNQYE 128

  Fly   178 LRC---KAKGSPEPTIKWKR----------DDGNKIVINKTLE--VH-DLETDSLELERISRLHM 226
            |:|   ....:...||.|.:          .|..|..:||.:.  :| |...|..:....:.|::
Zfish   129 LQCDIHNVAPAQNLTINWYKGETLVNQTNFTDNTKSPVNKIIRLLIHPDRADDGAQYRCETELNL 193

  Fly   227 GAYLCIASNGVPP-SVSKRIKVSVDFSPMVWIPH--QLVGIPIGFNITLECFIEANPTSLNYWTR 288
            |    :.....|| :.||.:.:.|.:.|.    |  ....|.....:.|.|.::|||.::..|..
Zfish   194 G----VEGPQPPPKNTSKPLSIDVHYKPQ----HSSSAENISQSDTVYLNCTVKANPAAVYTWHS 250

  Fly   289 ENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDY--GNYKCVAKNPRGDMDGNIKLYMSS 351
            |:   :.|                   :::...:|||..  |.|.|.|.|   |:..:.|:::.|
Zfish   251 EH---LKE-------------------KISSPVIQSSPLSPGKYTCTATN---DLGASSKVFIVS 290

  Fly   352 PPTTQPPPTTTTLRRTTTTAAEIA 375
                       :..|||..|..||
Zfish   291 -----------SAGRTTFWAIVIA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 19/101 (19%)
Ig 69..139 CDD:143165 14/69 (20%)
IG_like 165..249 CDD:214653 22/102 (22%)
IGc2 172..237 CDD:197706 16/80 (20%)
IG_like 267..348 CDD:214653 18/82 (22%)
Ig 270..339 CDD:299845 16/70 (23%)
si:ch211-74m13.1XP_001922015.4 Ig2_ICAM-1_like 109..209 CDD:143232 23/103 (22%)
Ig_2 217..281 CDD:290606 20/92 (22%)
IG_like 230..281 CDD:214653 17/75 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.