DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and nectin1l1

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_031752313.1 Gene:nectin1l1 / 100145297 XenbaseID:XB-GENE-22065634 Length:458 Species:Xenopus tropicalis


Alignment Length:356 Identity:77/356 - (21%)
Similarity:130/356 - (36%) Gaps:88/356 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LNNVISEDPEFTDVIE-NITVPAGRNVKLACSVKNLGSY-KVAWMHFEQSAILTVHNHVITRNPR 106
            |.:.:|...:.:.::: .:....|.:.||.|.||..... :|.|            ...::.|..
 Frog    18 LISALSVSAQVSVIVDREVNAKLGSDAKLNCKVKTPDIISQVTW------------QRKLSPNNE 70

  Fly   107 ISVTHDKHDK--HRTWF---------------LHINNVQEEDRGRYMCQINTVTAKTQYGFVKVV 154
            ..:|:.|.::  |.|.|               :.|.||...|:|.|:|...|....|:...:|:|
 Frog    71 NFLTYSKGEEPMHLTPFGQRVKFLGNGDLGGSIRIPNVTLADQGTYLCIFTTFPGGTKEAEIKLV 135

  Fly   155 --VPPNI-----DDALTS---SDIIVREGDNVTLRCKA-KGSPEPTIKWKRDDGNKIVINKTLEV 208
              |||.|     :..|:.   |.|.|         |:| ...|...|.|...:...|     .|.
 Frog   136 IQVPPKITLEPTEPVLSGPSPSPIAV---------CRAWAAKPAVNITWIFSEARYI-----SEE 186

  Fly   209 HDLETDSLELERISRL-------HMGAYL-CIASNGVPPSV---SKRIKVS-VDFSPMVWIPHQL 261
            :....::..:...|:|       |.|..: |:.|.....|:   |:.:.:. :.::|.|  ..::
 Frog   187 NSTNYENGTVSTCSQLVTVPLPGHNGRNVTCVVSQSDGKSMESWSQTLTIQHIYYAPEV--KAKV 249

  Fly   262 VGIPIGFNITLECFIEANPTSLNY-WTRENDQMITESSKYKTETIPGHPSYK-ATMRLTITNVQS 324
            :....| .|.|.|..:.||.:..: |.|  |:|          .:|.:.:.: ...||...|...
 Frog   250 IAKDDG-TIQLSCRADCNPPATEFLWKR--DEM----------DLPDNEAEELGATRLLSANTWK 301

  Fly   325 SDYGNYKCVAKNPRGDMDGNIKLYMSSPPTT 355
               |.|.|||.|..|...|.|.:...:.|.|
 Frog   302 ---GYYACVAGNEVGYSSGYIYVQTVTVPGT 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 25/116 (22%)
Ig 69..139 CDD:143165 20/87 (23%)
IG_like 165..249 CDD:214653 18/99 (18%)
IGc2 172..237 CDD:197706 13/73 (18%)
IG_like 267..348 CDD:214653 23/82 (28%)
Ig 270..339 CDD:299845 19/70 (27%)
nectin1l1XP_031752313.1 Ig 29..136 CDD:416386 24/118 (20%)
FR1 29..51 CDD:409353 4/21 (19%)
Ig strand A 29..32 CDD:409353 0/2 (0%)
Ig strand A' 34..38 CDD:409353 0/3 (0%)
Ig strand B 43..51 CDD:409353 3/7 (43%)
FR2 57..63 CDD:409353 2/17 (12%)
Ig strand C 58..63 CDD:409353 2/16 (13%)
CDR2 64..83 CDD:409353 3/18 (17%)
Ig strand C' 73..78 CDD:409353 1/4 (25%)
Ig strand C' 80..84 CDD:409353 0/3 (0%)
FR3 84..122 CDD:409353 9/37 (24%)
Ig strand D 91..95 CDD:409353 0/3 (0%)
Ig strand E 100..107 CDD:409353 1/6 (17%)
Ig strand F 114..122 CDD:409353 3/7 (43%)
CDR3 123..126 CDD:409353 0/2 (0%)
Ig strand G 126..136 CDD:409353 2/9 (22%)
FR4 127..136 CDD:409353 2/8 (25%)
Ig 140..237 CDD:416386 21/110 (19%)
Ig strand A 140..147 CDD:409353 2/6 (33%)
Ig strand B 158..165 CDD:409353 3/15 (20%)
Ig strand C 170..176 CDD:409353 1/5 (20%)
Ig strand D 180..188 CDD:409353 2/12 (17%)
Ig strand E 196..204 CDD:409353 2/7 (29%)
Ig strand F 214..221 CDD:409353 1/6 (17%)
Ig strand G 227..233 CDD:409353 1/5 (20%)
Ig 254..316 CDD:416386 21/77 (27%)
Ig strand B 255..264 CDD:409353 4/9 (44%)
Ig strand C 270..276 CDD:409353 1/5 (20%)
Ig strand C' 279..282 CDD:409353 1/12 (8%)
Ig strand D 285..290 CDD:409353 0/4 (0%)
Ig strand E 291..298 CDD:409353 2/6 (33%)
Ig strand F 302..310 CDD:409353 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.