DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DIP-epsilon and hmcn1

DIOPT Version :9

Sequence 1:	NP_001137799.1	Gene:	DIP-epsilon / 7354433	FlyBaseID:	FBgn0259714	Length:	467	Species:	Drosophila melanogaster
Sequence 2:	XP_012816895.2	Gene:	hmcn1 / 100135378	XenbaseID:	XB-GENE-6258572	Length:	5519	Species:	Xenopus tropicalis

Alignment Length:	442	Identity:	112/442 - (25%)
Similarity:	181/442 - (40%)	Gaps:	71/442 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    23 SVALSTDTG-----SEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYK 82
            :|....|.|     :|..||:| .|::|..:...|.....|::::|.......|.|:...:.:..
Frog  4136 AVVQPDDAGEYTCTAENIAGSV-NSSMNLSVLVPPRIVKNIKDVSVVINDQTTLPCAAHGIPTPT 4199

  Fly    83 VAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQI-NTVTAKT 146
            :.|               ...|..|:|...|:....:..|.:.|.|.:|.|.|.|.. |.:...|
Frog  4200 ITW---------------AKNNLPITVKAGKYSVLASGELILYNAQHKDVGTYTCTASNAIGEDT 4249

  Fly   147 QYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEV--- 208
            ....:.|..||:..:..|.  :.:.||:.::|.|||.|:|.|...|       |..:|.|.|
Frog  4250 HTVRLTVHFPPSFTEMPTI--VSLNEGERLSLLCKATGNPLPHTTW-------IFKDKILPVLQD 4305

  Fly   209 -HDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPM---VWIPHQLVGIPIGFN 269
             ...:.:.|.::::||.:.|||:|:|.| :..|::..|.|.|...|:   |...|:.|  |:|.|
Frog  4306 RRSKQQNELVIDKVSRENSGAYMCVAEN-IVASINTTIHVFVKEPPVLNGVHNKHRTV--PLGGN 4367

  Fly   270 ITLECFIEANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVA 334
            |.|.|.::.||.....|.:          |.|..:...|....:...|.|.:....|.|:|.|:|
Frog  4368 IILNCVVKGNPFPKIQWHK----------KAKVISYNKHIKEFSNGSLAIYDAGLEDVGDYTCIA 4422

  Fly   335 KNPRGDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTAAEIALDG---------YINTPLNG-NGI 389
            .|..|.::..:.|.:..|||.:.||..||:....|.|.....:|         ..|.|::. :.|
Frog  4423 ANDAGVLEHTVTLTLQRPPTIKVPPLDTTVDAGATVALNCQSEGEPVPTITWYRRNNPISSEDRI 4487

  Fly   390 GIVGEGPTNS---VIASGKSSIKY---LSNLNEIDKSKQKLTGSSPKGF-DW 434
            .|:   |.||   |.|..:.:..|   .:|:...|..|...|.....|| :|
Frog  4488 TIL---PNNSLQIVSAQKEDTSVYECKATNIMGTDVVKVTFTVQVHGGFSEW 4536

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DIP-epsilon	NP_001137799.1	IG_like	59..155	CDD:214653	18/96 (19%)
		Ig	69..139	CDD:143165	14/69 (20%)
		IG_like	165..249	CDD:214653	26/87 (30%)
		IGc2	172..237	CDD:197706	23/68 (34%)
		IG_like	267..348	CDD:214653	20/80 (25%)
		Ig	270..339	CDD:299845	17/68 (25%)
hmcn1	XP_012816895.2	Ig strand A	2010..2015	CDD:409353
		I-set	2011..2099	CDD:400151
		Ig strand A'	2019..2025	CDD:409353
		Ig strand B	2026..2036	CDD:409353
		Ig strand C	2040..2046	CDD:409353
		Ig strand C'	2048..2050	CDD:409353
		Ig strand D	2057..2060	CDD:409353
		Ig strand E	2065..2071	CDD:409353
		Ig strand F	2077..2086	CDD:409353
		Ig strand G	2089..2101	CDD:409353
		Ig_3	2102..2177	CDD:404760
		Ig strand A	2102..2105	CDD:409353
		Ig strand A'	2111..2114	CDD:409353
		Ig strand B	2120..2127	CDD:409353
		Ig strand C	2133..2138	CDD:409353
		Ig strand C'	2141..2143	CDD:409353
		Ig strand D	2149..2153	CDD:409353
		Ig strand E	2155..2160	CDD:409353
		Ig strand F	2169..2177	CDD:409353
		Ig strand G	2180..2190	CDD:409353
		Ig	2194..2285	CDD:416386
		Ig strand A	2194..2197	CDD:409353
		Ig strand A'	2202..2207	CDD:409353
		Ig strand B	2213..2220	CDD:409353
		Ig strand C	2226..2231	CDD:409353
		Ig strand C'	2233..2235	CDD:409353
		Ig strand D	2243..2247	CDD:409353
		Ig strand E	2251..2257	CDD:409353
		Ig strand F	2264..2271	CDD:409353
		Ig strand G	2277..2285	CDD:409353
		Ig_3	2288..2366	CDD:404760
		Ig strand A'	2300..2304	CDD:409353
		Ig strand B	2308..2315	CDD:409353
		Ig strand C	2322..2327	CDD:409353
		Ig strand C'	2329..2332	CDD:409353
		Ig strand D	2337..2341	CDD:409353
		Ig strand E	2344..2351	CDD:409353
		Ig strand F	2358..2366	CDD:409353
		Ig strand B	2403..2407	CDD:409353
		Ig	2404..2473	CDD:416386
		Ig strand C	2416..2420	CDD:409353
		Ig strand E	2439..2443	CDD:409353
		Ig strand F	2453..2458	CDD:409353
		I-set	2477..2565	CDD:400151
		Ig strand B	2495..2499	CDD:409353
		Ig strand C	2508..2512	CDD:409353
		Ig strand E	2531..2535	CDD:409353
		Ig strand F	2545..2550	CDD:409353
		Ig	2579..2660	CDD:416386
		Ig strand A'	2579..2584	CDD:409353
		Ig strand B	2590..2597	CDD:409353
		Ig strand C	2603..2608	CDD:409353
		Ig strand C'	2610..2612	CDD:409353
		Ig strand D	2619..2622	CDD:409353
		Ig strand E	2626..2632	CDD:409353
		Ig strand F	2639..2646	CDD:409353
		Ig strand G	2652..2660	CDD:409353
		I-set	2673..2758	CDD:400151
		Ig strand B	2689..2693	CDD:409353
		Ig strand C	2702..2706	CDD:409353
		Ig strand E	2725..2728	CDD:409353
		Ig strand F	2738..2743	CDD:409353
		Ig strand B	2794..2798	CDD:409353
		Ig	2795..2857	CDD:416386
Ig strand C	2807..2811	CDD:409353
Ig strand E	2830..2834	CDD:409353
Ig strand F	2844..2849	CDD:409353
I-set	2878..2961	CDD:400151
Ig strand A'	2886..2889	CDD:409353
Ig strand C	2904..2909	CDD:409353
Ig strand C'	2911..2913	CDD:409353
Ig strand D	2919..2923	CDD:409353
Ig strand E	2926..2932	CDD:409353
Ig strand F	2940..2948	CDD:409353
Ig_3	2964..3040	CDD:404760
Ig strand A	2967..2970	CDD:409353
Ig strand A'	2974..2977	CDD:409353
Ig strand B	2983..2990	CDD:409353
Ig strand C	2996..3001	CDD:409353
Ig strand D	3011..3015	CDD:409353
Ig strand E	3018..3024	CDD:409353
Ig strand F	3032..3040	CDD:409353
Ig strand G	3043..3053	CDD:409353
Ig strand A	3056..3061	CDD:409353
Ig strand A'	3067..3073	CDD:409353
I-set	3070..3148	CDD:400151
Ig strand B	3076..3086	CDD:409353
Ig strand C	3090..3096	CDD:409353
Ig strand C'	3098..3100	CDD:409353
Ig strand D	3106..3109	CDD:409353
Ig strand E	3114..3120	CDD:409353
Ig strand F	3126..3135	CDD:409353
Ig strand G	3138..3150	CDD:409353
Ig	3169..3242	CDD:416386
Ig strand B	3170..3174	CDD:409353
Ig strand C	3183..3187	CDD:409353
Ig strand E	3208..3212	CDD:409353
Ig strand F	3222..3227	CDD:409353
Ig strand A	3245..3250	CDD:409353
Ig strand A'	3254..3260	CDD:409353
I-set	3259..3329	CDD:400151
Ig strand B	3263..3273	CDD:409353
Ig strand C	3277..3283	CDD:409353
Ig strand C'	3285..3287	CDD:409353
Ig strand D	3295..3298	CDD:409353
Ig strand E	3303..3309	CDD:409353
Ig strand F	3315..3324	CDD:409353
Ig strand G	3327..3339	CDD:409353
I-set	3341..3431	CDD:400151
Ig strand B	3361..3368	CDD:409353
Ig strand C	3374..3379	CDD:409353
Ig strand C'	3381..3383	CDD:409353
Ig strand D	3389..3393	CDD:409353
Ig strand E	3397..3402	CDD:409353
Ig strand F	3411..3417	CDD:409353
Ig	3444..3524	CDD:416386
Ig strand A'	3445..3448	CDD:409353
Ig strand B	3454..3461	CDD:409353
Ig strand C	3467..3472	CDD:409353
Ig strand C'	3474..3476	CDD:409353
Ig strand D	3481..3486	CDD:409353
Ig strand E	3489..3495	CDD:409353
Ig strand F	3503..3511	CDD:409353
Ig strand G	3514..3524	CDD:409353
Ig strand A	3527..3532	CDD:409353
Ig strand A'	3536..3542	CDD:409353
Ig	3539..3617	CDD:416386
Ig strand B	3545..3555	CDD:409353
Ig strand C	3559..3565	CDD:409353
Ig strand C'	3567..3569	CDD:409353
vWFA	43..199	CDD:238119
MD	295..418	CDD:214741
IGc2	446..507	CDD:197706
Ig strand B	449..452	CDD:409353
Ig strand C	461..465	CDD:409353
Ig strand E	483..487	CDD:409353
Ig strand F	497..502	CDD:409353
Ig strand G	511..514	CDD:409353
Ig	521..608	CDD:416386
Ig strand A'	529..532	CDD:409353
Ig strand B	538..545	CDD:409353
Ig strand C	551..556	CDD:409353
Ig strand C'	558..560	CDD:409353
Ig strand D	568..572	CDD:409353
Ig strand E	575..580	CDD:409353
Ig strand F	588..596	CDD:409353
Ig strand G	599..607	CDD:409353
I-set	613..691	CDD:400151
Ig strand A'	621..624	CDD:409353
Ig strand B	630..637	CDD:409353
Ig strand C	643..648	CDD:409353
Ig strand C'	650..652	CDD:409353
Ig strand D	658..663	CDD:409353
Ig strand E	665..669	CDD:409353
Ig strand F	678..686	CDD:409353
Ig strand G	689..700	CDD:409353
Ig_3	703..777	CDD:404760
Ig strand A'	709..714	CDD:409353
Ig strand B	718..725	CDD:409353
Ig strand C	733..737	CDD:409353
Ig strand D	749..752	CDD:409353
Ig strand E	756..761	CDD:409353
Ig strand F	769..777	CDD:409353
Ig strand G	783..790	CDD:409353
I-set	794..885	CDD:400151
Ig strand A	794..797	CDD:409353
Ig strand A'	802..805	CDD:409353
Ig strand B	811..818	CDD:409353
Ig strand C	824..835	CDD:409353
Ig strand C'	838..840	CDD:409353
Ig strand D	845..849	CDD:409353
Ig strand E	851..855	CDD:409353
Ig strand F	864..872	CDD:409353
Ig strand G	875..885	CDD:409353
Ig_3	891..965	CDD:404760
Ig strand A'	899..901	CDD:409353
Ig strand B	907..915	CDD:409353
Ig strand C	922..927	CDD:409353
Ig strand C'	929..932	CDD:409353
Ig strand D	937..941	CDD:409353
Ig strand E	944..950	CDD:409353
Ig strand F	957..965	CDD:409353
Ig strand G	968..972	CDD:409353
Ig strand G'	974..978	CDD:409353
PHA02785	991..1258	CDD:165149
Ig	1268..1355	CDD:416386
Ig strand A'	1272..1275	CDD:409353
Ig strand B	1284..1291	CDD:409353
Ig strand C	1297..1302	CDD:409353
Ig strand C'	1305..1307	CDD:409353
Ig strand D	1313..1319	CDD:409353
Ig strand E	1321..1325	CDD:409353
Ig strand F	1334..1342	CDD:409353
Ig strand G	1345..1355	CDD:409353
Ig	1366..1448	CDD:416386
Ig strand B	1378..1382	CDD:409353
Ig strand C	1391..1395	CDD:409353
Ig strand E	1413..1418	CDD:409353
Ig strand F	1428..1433	CDD:409353
Ig strand G	1442..1445	CDD:409353
I-set	1457..1542	CDD:400151
Ig strand A'	1462..1465	CDD:409353
Ig strand B	1471..1478	CDD:409353
Ig strand C	1484..1489	CDD:409353
Ig strand C'	1491..1493	CDD:409353
Ig strand D	1500..1504	CDD:409353
Ig strand E	1507..1513	CDD:409353
Ig strand F	1521..1529	CDD:409353
Ig strand G	1532..1542	CDD:409353
Ig	1565..1629	CDD:416386
Ig strand B	1565..1569	CDD:409353
Ig strand C	1578..1582	CDD:409353
Ig strand E	1601..1605	CDD:409353
Ig strand F	1615..1620	CDD:409353
I-set	1649..1729	CDD:400151
Ig strand B	1659..1666	CDD:409353
Ig strand C	1672..1677	CDD:409353
Ig strand D	1688..1691	CDD:409353
Ig strand E	1695..1701	CDD:409353
Ig strand F	1708..1715	CDD:409353
Ig strand G	1721..1729	CDD:409353
I-set	1741..1822	CDD:400151
Ig strand A'	1743..1746	CDD:409353
Ig strand B	1752..1759	CDD:409353
Ig strand C	1765..1770	CDD:409353
Ig strand C'	1772..1774	CDD:409353
Ig strand D	1780..1784	CDD:409353
Ig strand E	1787..1793	CDD:409353
Ig strand F	1801..1809	CDD:409353
Ig	<1844..1914	CDD:416386
Ig strand C	1856..1860	CDD:409353
Ig strand C'	1863..1866	CDD:409353
Ig strand D	1872..1876	CDD:409353
Ig strand E	1880..1885	CDD:409353
Ig strand F	1893..1901	CDD:409353
Ig strand G	1904..1914	CDD:409353
Ig	1937..2007	CDD:416386
Ig strand B	1937..1941	CDD:409353
Ig strand C	1950..1954	CDD:409353
Ig strand E	1973..1977	CDD:409353
Ig strand F	1987..1992	CDD:409353
Ig strand D	3576..3579	CDD:409353
Ig strand E	3583..3589	CDD:409353
Ig strand F	3595..3604	CDD:409353
Ig strand G	3607..3617	CDD:409353
I-set	3630..3710	CDD:400151
Ig strand A'	3631..3634	CDD:409353
Ig strand B	3640..3647	CDD:409353
Ig strand C	3653..3658	CDD:409353
Ig strand C'	3660..3662	CDD:409353
Ig strand D	3668..3672	CDD:409353
Ig strand E	3675..3681	CDD:409353
Ig strand F	3689..3697	CDD:409353
Ig_3	3713..3788	CDD:404760
Ig strand A'	3722..3725	CDD:409353
Ig strand B	3731..3738	CDD:409353
Ig strand C	3744..3749	CDD:409353
Ig strand C'	3751..3753	CDD:409353
Ig strand D	3760..3764	CDD:409353
Ig strand E	3767..3772	CDD:409353
Ig strand F	3780..3788	CDD:409353
Ig strand G	3791..3801	CDD:409353
Ig_3	3804..3879	CDD:404760
Ig strand B	3823..3826	CDD:409353
Ig strand C	3835..3839	CDD:409353
Ig strand E	3860..3864	CDD:409353
Ig strand F	3874..3879	CDD:409353
Ig strand A'	3906..3909	CDD:409353
Ig	3908..3985	CDD:416386
Ig strand B	3915..3922	CDD:409353
Ig strand C	3928..3933	CDD:409353
Ig strand C'	3935..3937	CDD:409353
Ig strand D	3944..3948	CDD:409353
Ig strand E	3951..3956	CDD:409353
Ig strand F	3964..3972	CDD:409353
Ig strand G	3975..3985	CDD:409353
I-set	3989..4075	CDD:400151
Ig strand B	4006..4013	CDD:409353
Ig strand C	4019..4024	CDD:409353
Ig strand C'	4026..4028	CDD:409353
Ig strand D	4034..4038	CDD:409353
Ig strand E	4041..4046	CDD:409353
Ig strand F	4054..4062	CDD:409353
Ig strand G	4065..4075	CDD:409353
Ig_3	4078..4152	CDD:404760	3/15 (20%)
Ig strand C	4109..4113	CDD:409353
Ig strand C'	4116..4119	CDD:409353
Ig strand D	4126..4129	CDD:409353
Ig strand E	4131..4136	CDD:409353	112/442 (25%)
Ig strand F	4144..4152	CDD:409353	1/7 (14%)
Ig strand G	4155..4165	CDD:409353	4/10 (40%)
Ig strand A	4168..4171	CDD:409353	1/2 (50%)
I-set	4169..4256	CDD:400151	19/101 (19%)
Ig strand A'	4177..4180	CDD:409353	0/2 (0%)
Ig strand B	4185..4193	CDD:409353	2/7 (29%)
Ig strand C	4199..4203	CDD:409353	1/18 (6%)
Ig strand C'	4206..4209	CDD:409353	1/2 (50%)
Ig strand D	4215..4219	CDD:409353	1/3 (33%)
Ig strand E	4222..4227	CDD:409353	1/4 (25%)
Ig strand F	4235..4243	CDD:409353	3/7 (43%)
Ig strand G	4246..4256	CDD:409353	1/9 (11%)
Ig_3	4259..4333	CDD:404760	25/82 (30%)
putative Ig strand A	4260..4266	CDD:409353	1/5 (20%)
Ig strand B	4277..4281	CDD:409353	1/3 (33%)
Ig strand C	4290..4295	CDD:409353	1/11 (9%)
Ig strand E	4312..4316	CDD:409353	1/3 (33%)
Ig strand F	4326..4331	CDD:409353	3/4 (75%)
Ig strand G	4339..4342	CDD:409353	0/2 (0%)
Ig	4358..4436	CDD:416386	23/89 (26%)
Ig strand B	4368..4375	CDD:409353	3/6 (50%)
Ig strand C	4381..4386	CDD:409353	1/4 (25%)
Ig strand C'	4388..4390	CDD:409353	0/1 (0%)
Ig strand D	4396..4400	CDD:409353	1/3 (33%)
Ig strand E	4403..4408	CDD:409353	1/4 (25%)
Ig strand F	4416..4424	CDD:409353	4/7 (57%)
Ig strand G	4427..4436	CDD:409353	1/8 (13%)
Ig	4443..4527	CDD:416386	20/86 (23%)
Ig strand A'	4449..4452	CDD:409353	1/2 (50%)
Ig strand B	4458..4465	CDD:409353	1/6 (17%)
Ig strand C	4471..4476	CDD:409353	0/4 (0%)
Ig strand C'	4478..4480	CDD:409353	1/1 (100%)
Ig strand D	4486..4490	CDD:409353	1/3 (33%)
Ig strand E	4493..4498	CDD:409353	2/4 (50%)
Ig strand F	4506..4514	CDD:409353	1/7 (14%)
Ig strand G	4517..4527	CDD:409353	2/9 (22%)
TSP1	4534..4585	CDD:214559	1/3 (33%)
TSP1	4590..4642	CDD:214559
TSP1	4647..4699	CDD:214559
TSP1	4704..4756	CDD:214559
TSP1	4761..4813	CDD:214559
TSP1	4818..4870	CDD:214559
nidG2	4869..5093	CDD:412205
cEGF	5128..5151	CDD:403760
EGF_CA	5148..5183	CDD:214542
EGF_CA	5193..5230	CDD:214542
EGF_CA	5231..5272	CDD:214542
EGF_CA	5273..5314	CDD:311536
EGF_CA	5316..5355	CDD:214542
EGF_CA	5356..>5391	CDD:214542
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	58	1.000	Domainoid score	I10578
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.910