DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and negr1

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:315 Identity:92/315 - (29%)
Similarity:145/315 - (46%) Gaps:42/315 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISV-THDKHDKHRTWF 121
            ::|:.|..|....|.|.::. |:.|.||::  :|:|:.......:.:||:|: |..|.:    :.
 Frog    46 VDNLVVRQGETAMLRCFLEE-GASKGAWLN--RSSIIFAGGDKWSVDPRVSIATSSKQE----YS 103

  Fly   122 LHINNVQEEDRGRYMCQINTV-TAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGS 185
            |.|..|...|.|.|.|.:.|. :.:|....:.|.|.|.|.|  .|||:.|.||.||:|.|.|.|.
 Frog   104 LRIQKVDVSDDGPYTCSVQTEHSPRTLQVHLTVHVSPKIYD--ISSDMTVNEGTNVSLICLATGK 166

  Fly   186 PEPTIKWKR--DDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVP-PSVSKRIKV 247
            |||:|.|:.  ....:....:.|:::.          |:|...|.|.|.|.|.|. |.| |::||
 Frog   167 PEPSISWRHISPSAKQFGSGQYLDIYG----------ITRDQAGDYECSAENDVSFPDV-KKVKV 220

  Fly   248 SVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTR-----ENDQMITESSKYKTETIPG 307
            :|:|:|.: :.....|:.:|....:.|...|.|..:..|.:     .|.|.......|.|.:|  
 Frog   221 TVNFAPTI-LEITPTGVSLGRTGLIRCETAAVPAPVFEWYKGEKKLTNGQRGIRIQNYNTRSI-- 282

  Fly   308 HPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTTQPPPTTT 362
                     ||::||....:|||.|||.|..|..:.::.|.....|:|..|.|::
 Frog   283 ---------LTVSNVTEEHFGNYTCVAVNKLGTSNASLPLNQIIEPSTTSPVTSS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 26/97 (27%)
Ig 69..139 CDD:143165 20/70 (29%)
IG_like 165..249 CDD:214653 31/86 (36%)
IGc2 172..237 CDD:197706 21/66 (32%)
IG_like 267..348 CDD:214653 22/85 (26%)
Ig 270..339 CDD:299845 20/73 (27%)
negr1XP_031755650.1 Ig 44..136 CDD:416386 25/96 (26%)
FR1 44..62 CDD:409353 4/15 (27%)
Ig strand A' 47..53 CDD:409353 2/5 (40%)
Ig strand B 55..63 CDD:409353 2/7 (29%)
CDR1 63..68 CDD:409353 1/5 (20%)
FR2 69..75 CDD:409353 3/7 (43%)
Ig strand C 69..74 CDD:409353 3/4 (75%)
CDR2 76..87 CDD:409353 2/10 (20%)
Ig strand C' 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
FR3 88..122 CDD:409353 12/37 (32%)
Ig strand D 91..98 CDD:409353 3/6 (50%)
Ig strand E 101..107 CDD:409353 1/9 (11%)
Ig strand F 114..122 CDD:409353 3/7 (43%)
CDR3 123..127 CDD:409353 1/3 (33%)
Ig strand G 127..136 CDD:409353 1/8 (13%)
FR4 129..136 CDD:409353 1/6 (17%)
Ig_3 140..208 CDD:404760 27/79 (34%)
Ig strand A' 146..151 CDD:409353 3/4 (75%)
Ig strand B 157..164 CDD:409353 3/6 (50%)
Ig strand C 170..175 CDD:409353 2/4 (50%)
Ig strand C' 177..179 CDD:409353 0/1 (0%)
Ig strand E 187..193 CDD:409353 1/5 (20%)
Ig strand F 200..207 CDD:409353 3/6 (50%)
Ig strand G 214..222 CDD:409353 4/8 (50%)
Ig_3 226..302 CDD:404760 22/87 (25%)
putative Ig strand A 226..232 CDD:409353 1/6 (17%)
Ig strand B 242..246 CDD:409353 0/3 (0%)
Ig strand C 255..259 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 2/14 (14%)
Ig strand F 295..300 CDD:409353 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4412
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.