DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and cd276

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_031754988.1 Gene:cd276 / 100101669 XenbaseID:XB-GENE-921537 Length:308 Species:Xenopus tropicalis


Alignment Length:197 Identity:48/197 - (24%)
Similarity:75/197 - (38%) Gaps:47/197 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 RISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQIN-------TVTAKTQYGFVKVVVPPNIDDAL 163
            ||.:.|::..|.....| :..||..|.|.|:|.:|       :|:.:....|.|..:.....:||
 Frog    82 RIGLFHEELSKGNMSLL-LQRVQLIDEGIYICFVNVQNSSYASVSLQVGASFTKPTLHLEPSEAL 145

  Fly   164 TSSDIIVREGDNVTLRCKA-KGSPEPTIKWKRDDGNKIVINKTLE--------VHDLETDSLELE 219
                   :.||.||:.|.. .|.||..|.|:..:|..:..|.|..        .|...:.|:.||
 Frog   146 -------KPGDQVTVTCHTYDGYPEADILWQNGEGKNMTENVTTSQVANEKGLFHVQSSLSVILE 203

  Fly   220 RISRLHMGAYLCIASNGVPPSVSKRIKVS-------VDFSPMV-WIPHQLVGIPIGFNITLECFI 276
            .     ...|.|:..|   |.:.:....|       :.|.|:| |       :.:|.:|.|.|.:
 Frog   204 T-----SDTYTCLVFN---PVLQEETHASLTVTGQHLSFPPVVLW-------VTVGLSICLLCLL 253

  Fly   277 EA 278
            .|
 Frog   254 VA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 15/55 (27%)
Ig 69..139 CDD:143165 11/32 (34%)
IG_like 165..249 CDD:214653 22/99 (22%)
IGc2 172..237 CDD:197706 20/73 (27%)
IG_like 267..348 CDD:214653 5/12 (42%)
Ig 270..339 CDD:299845 4/9 (44%)
cd276XP_031754988.1 Ig 19..132 CDD:416386 13/50 (26%)
FR1 19..38 CDD:409353
Ig strand A 19..22 CDD:409353
Ig strand A' 24..28 CDD:409353
Ig strand B 31..38 CDD:409353
CDR1 39..47 CDD:409353
FR2 49..59 CDD:409353
Ig strand C 49..56 CDD:409353
CDR2 60..76 CDD:409353
Ig strand C' 61..66 CDD:409353
Ig strand C' 73..76 CDD:409353
FR3 79..117 CDD:409353 12/35 (34%)
Ig strand D 82..88 CDD:409353 2/5 (40%)
Ig strand E 94..100 CDD:409353 1/6 (17%)
Ig strand F 109..117 CDD:409353 3/7 (43%)
CDR3 118..120 CDD:409353 0/1 (0%)
Ig strand G 120..129 CDD:409353 1/8 (13%)
FR4 121..132 CDD:409353 1/10 (10%)
Ig 138..221 CDD:416386 23/97 (24%)
Ig strand B 151..159 CDD:409353 3/7 (43%)
Ig strand C 164..169 CDD:409353 1/4 (25%)
Ig strand C' 170..177 CDD:409353 1/6 (17%)
Ig strand D 181..187 CDD:409353 1/5 (20%)
Ig strand E 191..200 CDD:409353 1/8 (13%)
Ig strand F 207..215 CDD:409353 3/10 (30%)
Ig strand G 218..225 CDD:409353 0/6 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.