DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and XB5805949

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001090880.1 Gene:XB5805949 / 100038306 XenbaseID:XB-GENE-5805950 Length:353 Species:Xenopus tropicalis


Alignment Length:93 Identity:23/93 - (24%)
Similarity:38/93 - (40%) Gaps:39/93 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SFLY-VGLGCLIASSVALSTDTGSEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLAC 73
            :|:: |||||.|.:.|.|.          .:|...:..::|                     |||
 Frog   229 NFMFGVGLGCFILNLVELH----------YLGWFYVFRILS---------------------LAC 262

  Fly    74 SV----KNLGSYKVAWMHFEQSAILTVH 97
            |.    |::...||  :|.||:::| :|
 Frog   263 SACCDFKSIKKPKV--LHPEQNSLL-IH 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 12/43 (28%)
Ig 69..139 CDD:143165 12/33 (36%)
IG_like 165..249 CDD:214653
IGc2 172..237 CDD:197706
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
XB5805949NP_001090880.1 Connexin 3..251 CDD:365820 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.