DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and si:rp71-36a1.3

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_003201021.1 Gene:si:rp71-36a1.3 / 100034563 ZFINID:ZDB-GENE-050208-566 Length:385 Species:Danio rerio


Alignment Length:263 Identity:65/263 - (24%)
Similarity:102/263 - (38%) Gaps:53/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LSTDTG--SEGNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHF 88
            ::.|:|  ...|...|..|...:|:|:|.     ::.|:|..|..:.|...:.::.........|
Zfish    95 MTADSGDYEVSNENGVKKSFKVSVVSDDS-----VKTISVVKGDYITLLTGLPDMKRISAIQWRF 154

  Fly    89 EQSAILTVHNHVIT--RNPRISVTHDKHDK--------HRTWFLHINNVQEEDRGRYMCQINTVT 143
            :.      ||..|.  :...|.:..|..::        :.|..|.|.|:..|..|.|...|.:.:
Zfish   155 KH------HNSTIAEMKTGNIFIYDDTDERFKDKLLLNYTTGSLTIANIGTEHDGDYEVDIISSS 213

  Fly   144 AKT--QYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDD------GN-K 199
            ..|  |...|.|:||.....:|    ||..||..|||:...|......|:|:.:|      || |
Zfish   214 GYTLHQSYNVTVIVPTGDFKSL----IIEEEGALVTLQTGTKIQVNDLIQWRFEDTDLTPGGNLK 274

  Fly   200 IVINKTLEVHDLETDSLELERISRLHMGAY-LCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVG 263
            ..:|.     |::|.||.:....|...|.| |.|..:..  |:.|:..|:|..:|         |
Zfish   275 DGLNM-----DMKTGSLTIINPRRTDSGFYDLKIIRSRY--SIHKKFTVAVYGAP---------G 323

  Fly   264 IPI 266
            .||
Zfish   324 SPI 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 22/107 (21%)
Ig 69..139 CDD:143165 14/79 (18%)
IG_like 165..249 CDD:214653 27/91 (30%)
IGc2 172..237 CDD:197706 22/72 (31%)
IG_like 267..348 CDD:214653 65/263 (25%)
Ig 270..339 CDD:299845
si:rp71-36a1.3XP_003201021.1 IG_like 20..118 CDD:214653 5/22 (23%)
Ig 27..118 CDD:299845 5/22 (23%)
Ig 130..225 CDD:299845 19/100 (19%)
Ig 244..319 CDD:299845 23/81 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.