DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-epsilon and vsig10

DIOPT Version :9

Sequence 1:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001093564.2 Gene:vsig10 / 100005564 ZFINID:ZDB-GENE-030131-7476 Length:529 Species:Danio rerio


Alignment Length:391 Identity:96/391 - (24%)
Similarity:155/391 - (39%) Gaps:103/391 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SSVALSTDTGSEGNAGNVGGST-LNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAW 85
            |.:.|:...|..|.:.::..:| |||            ..:.|..|.||..:||.::..|..:.|
Zfish   110 SKIQLTIAAGPTGVSLDISPATFLNN------------GTLFVHKGSNVNFSCSSESNPSQNLTW 162

  Fly    86 MHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMC-QINTVTAKTQYG 149
                     ||.| :.:.||.    .:...|....| .|.|:|..|:|.|.| ..||::.:|...
Zfish   163 ---------TVDN-LASDNPE----REFGSKSPLAF-SITNIQPLDQGTYTCTSQNTLSRRTANK 212

  Fly   150 FVKVVV---PPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDG--NKIVINKTLEVH 209
            ..:::|   |....:.  |.::..:..|.:.:.....|.|.||:.|:..:|  ....||.|.   
Zfish   213 TQELLVYYAPERHPEC--SWELGDKPSDVLFICSWFGGYPVPTLTWQEVEGAAEGPTINLTT--- 272

  Fly   210 DLETDSLELERISR--LHMGAYL-CIASN--GVPPSVSKRIKVSVDFSPMVWIPHQLVGIPI--- 266
            ..:|:.|.:. ::|  ||.|..: |...:  ||..|.|..:|          ||:. .|.|:   
Zfish   273 SQQTEELNVS-VNRSILHDGDKVKCTGHHVTGVEKSCSFTLK----------IPYP-TGQPLATA 325

  Fly   267 --GFNITLECFIEAN-PTSLNYWTRENDQMITESSKYKTETIPGHPSYKATMRLTITNVQSSDYG 328
              |.|||:.|...:: |.:...| ::||.:|..:|||..:      ..:..:.|||.||..:|.|
Zfish   326 LEGTNITISCTETSSLPPAKTVW-KKNDDLIENTSKYIVQ------ENRPALTLTIVNVTKADEG 383

  Fly   329 NYKCVAKNPRGDMDGNIKLYMSSPPTTQPPPTTTTLRRTTTTAAEIALDGYINTPLN-GNGIGIV 392
            .|.|.::||.|..:                                 |:.|:|...: |||..||
Zfish   384 VYYCYSENPLGARE---------------------------------LEVYLNVKTSAGNGGAIV 415

  Fly   393 G 393
            |
Zfish   416 G 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 25/96 (26%)
Ig 69..139 CDD:143165 19/70 (27%)
IG_like 165..249 CDD:214653 23/90 (26%)
IGc2 172..237 CDD:197706 17/71 (24%)
IG_like 267..348 CDD:214653 25/81 (31%)
Ig 270..339 CDD:299845 22/69 (32%)
vsig10NP_001093564.2 IG_like 28..116 CDD:214653 2/5 (40%)
Ig 32..104 CDD:299845
IG_like 140..204 CDD:214653 22/78 (28%)
IGc2 143..203 CDD:197706 21/74 (28%)
IG_like 324..404 CDD:214653 27/119 (23%)
Ig 328..404 CDD:299845 27/115 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.