DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42231 and Hyls1

DIOPT Version :9

Sequence 1:NP_001137828.1 Gene:CG42231 / 7354432 FlyBaseID:FBgn0087041 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_002729970.1 Gene:Hyls1 / 680262 RGDID:1594169 Length:313 Species:Rattus norvegicus


Alignment Length:261 Identity:53/261 - (20%)
Similarity:79/261 - (30%) Gaps:81/261 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EERLAENAK----------ESDFSGLHKRGTVSSRAKLSLDKDKENAAP---------------- 80
            |||:...|.          |.|.....:.|.....:|.|:...|..|.|                
  Rat    31 EERMLAAATAFTHICAGQGEGDSRREVQAGQYDPYSKASITPGKRAALPMHLHFPYTGSHVTSST 95

  Fly    81 ------SCPCPSAKEKECKTDKDDD--------LKERSDGGASFADL----ARLFKEQLLMDASV 127
                  .|..|..|.|..:...|.:        :.|...|..|..||    .||...| ..:.:.
  Rat    96 VSETSQKCRKPVMKRKVLRRKPDGEVLVTDESIISESESGTESDLDLWDLRHRLMNLQ-FQEGTA 159

  Fly   128 PPMSANNAVPQKSQVNGRRRSR---SKTRREKAPSISSSESEANEDRLRMQRRRRSKSHPR-SAS 188
            .|:..:..:....:..|..:.:   ...|.|..|.:       .|..|.:..|.:|...|| ...
  Rat   160 SPVDTSQKLNLPCEYQGISQDQLICYLQREEMGPPV-------YEQDLIVASRPKSFILPRLDQL 217

  Fly   189 NRRSGSVHQRRKSMHCDPVALFQYYQKEWAHFRSQIPGENTRIGVR--------------SKPMG 239
            :|..|.:         |.||.:..|:::|...|  .|||:.|..:|              |||..
  Rat   218 SRNRGKI---------DRVARYFEYKRDWDSMR--FPGEDNRKELRWSVRGQMLSRPEPQSKPQH 271

  Fly   240 L 240
            |
  Rat   272 L 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42231NP_001137828.1 HYLS1_C 197..>234 CDD:291957 10/36 (28%)
Hyls1XP_002729970.1 HYLS1_C 212..298 CDD:291957 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR34174
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.